Recombinant Human Epsin 1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Epsin 1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 346-428 of Human EPN1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PAPAFSDPWGGSPAKPSTNGTTAGGFDTEPDEFSDFDRLRTALPTSGSSAGELELLAGEVPARSPGAFDMSGVRGSLAEAVGS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
EPN1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Epsin 1 Protein

  • EH domain-binding mitotic phosphoprotein
  • EPS-15-interacting protein 1
  • epsin 1
  • epsin-1

Background

EPN1 is an endocytic accessory protein that interacts with EPS15 (MIM 600051), the alpha subunit of the clathrin adaptor AP2 (AP2A1; MIM 601026), and clathrin (see MIM 118960), as well as with other accessory proteins for the endocytosis of clathrin-coated vesicles.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB8480
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-01775
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90146
Species: Hu
Applications: IHC, IHC-P
NBP1-86658
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00009685-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00009146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-98474
Species: Hu
Applications: WB
NB100-74633
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-86170
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00029924-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Epsin 1 Partial Recombinant Protein (H00029924-Q01) (0)

There are no publications for Epsin 1 Partial Recombinant Protein (H00029924-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Epsin 1 Partial Recombinant Protein (H00029924-Q01) (0)

There are no reviews for Epsin 1 Partial Recombinant Protein (H00029924-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Epsin 1 Partial Recombinant Protein (H00029924-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Epsin 1 Products

Bioinformatics Tool for Epsin 1 Partial Recombinant Protein (H00029924-Q01)

Discover related pathways, diseases and genes to Epsin 1 Partial Recombinant Protein (H00029924-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Epsin 1 Partial Recombinant Protein (H00029924-Q01)

Discover more about diseases related to Epsin 1 Partial Recombinant Protein (H00029924-Q01).
 

Pathways for Epsin 1 Partial Recombinant Protein (H00029924-Q01)

View related products by pathway.

PTMs for Epsin 1 Partial Recombinant Protein (H00029924-Q01)

Learn more about PTMs related to Epsin 1 Partial Recombinant Protein (H00029924-Q01).

Blogs on Epsin 1

There are no specific blogs for Epsin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Epsin 1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EPN1