Epsin 1 Antibody

Images

 
Western Blot: Epsin 1 Antibody [NBP2-87371] - Host: Rabbit. Target Name: EPN1. Sample Tissue: Human Leiomyosarcoma Tumor lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Epsin 1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human Epsin 1. Peptide sequence: QLPMDYVQRVKRTHSQGGYGSQGYKYNWKLDEARKNLLRTHTTSASARAL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
EPN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Epsin 1 Antibody

  • EH domain-binding mitotic phosphoprotein
  • EPS-15-interacting protein 1
  • epsin 1
  • epsin-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB8480
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-01775
Species: Hu, Mu, Rt, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90146
Species: Hu
Applications: IHC, IHC-P
NBP1-86658
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00009685-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00009146-M01
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, S-ELISA, KD
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15669
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-74632
Species: Hu
Applications: WB, IP
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-86170
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Epsin 1 Antibody (NBP2-87371) (0)

There are no publications for Epsin 1 Antibody (NBP2-87371).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Epsin 1 Antibody (NBP2-87371) (0)

There are no reviews for Epsin 1 Antibody (NBP2-87371). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Epsin 1 Antibody (NBP2-87371) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Epsin 1 Products

Bioinformatics Tool for Epsin 1 Antibody (NBP2-87371)

Discover related pathways, diseases and genes to Epsin 1 Antibody (NBP2-87371). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Epsin 1 Antibody (NBP2-87371)

Discover more about diseases related to Epsin 1 Antibody (NBP2-87371).
 

Pathways for Epsin 1 Antibody (NBP2-87371)

View related products by pathway.

PTMs for Epsin 1 Antibody (NBP2-87371)

Learn more about PTMs related to Epsin 1 Antibody (NBP2-87371).

Blogs on Epsin 1

There are no specific blogs for Epsin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Epsin 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EPN1