EphA5 Antibody (X1)

Images

 
Western Blot: EphA5 Antibody (X1) [H00002044-M05] - Detection against Immunogen (36.63 KDa).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
X1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

EphA5 Antibody (X1) Summary

Immunogen
EPHA5 (NP_004430 234 a.a. - 333 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PSVVRHLAVFPDTITGADSSQLLEVSGSCVNHSVTDEPPKMHCSAEGEWLVPIGKCMCKAGYEEKNGTCQVCRPGFFKASPHIQSCGKCPPHSYTHEEAS
Specificity
This product is specific for Human EPHA5 monoclonal antibody (M01), clone X1 [Gene ID: 2044].
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EPHA5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EphA5 Antibody (X1)

  • Bsk
  • Cek7
  • EC 2.7.10
  • EC 2.7.10.1
  • Ehk1
  • EHK-1
  • EHK1Hek7
  • EK7
  • EPH homology kinase 1
  • Eph homology kinase-1
  • EPH receptor A5
  • EphA5
  • EPH-like kinase 7
  • ephrin type-A receptor 5
  • Hek7
  • receptor protein-tyrosine kinase HEK7
  • Rek7
  • TYRO4HEK7CEK7
  • tyrosine-protein kinase receptor EHK-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

374-EA
Species: Hu
AF3034
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
AF603
Species: Mu
Applications: WB, Block, ICC
AF641
Species: Mu
Applications: WB, IHC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
359-EA
Species: Hu
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-47761
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
640-A3
Species: Mu
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00002051-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-13964
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
7570-GH
Species: Hu
AF454
Species: Mu
Applications: WB
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC

Publications for EphA5 Antibody (H00002044-M05) (0)

There are no publications for EphA5 Antibody (H00002044-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EphA5 Antibody (H00002044-M05) (0)

There are no reviews for EphA5 Antibody (H00002044-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EphA5 Antibody (H00002044-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EphA5 Products

Bioinformatics Tool for EphA5 Antibody (H00002044-M05)

Discover related pathways, diseases and genes to EphA5 Antibody (H00002044-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EphA5 Antibody (H00002044-M05)

Discover more about diseases related to EphA5 Antibody (H00002044-M05).
 

Pathways for EphA5 Antibody (H00002044-M05)

View related products by pathway.

PTMs for EphA5 Antibody (H00002044-M05)

Learn more about PTMs related to EphA5 Antibody (H00002044-M05).
 

Research Areas for EphA5 Antibody (H00002044-M05)

Find related products by research area.

Blogs on EphA5

There are no specific blogs for EphA5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EphA5 Antibody (X1) and receive a gift card or discount.

Bioinformatics

Gene Symbol EPHA5
Entrez
Uniprot