EphA5 Antibody (5C8) Summary
Immunogen |
EPHA5 (NP_004430, 234 a.a. ~ 333 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PSVVRHLAVFPDTITGADSSQLLEVSGSCVNHSVTDEPPKMHCSAEGEWLVPIGKCMCKAGYEEKNGTCQVCRPGFFKASPHIQSCGKCPPHSYTHEEAS |
Specificity |
EPHA5 - EPH receptor A5 |
Isotype |
IgG3 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
EPHA5 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for EphA5 Antibody (5C8)
Background
This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Bind
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Mu
Applications: BA
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu
Applications: Bind
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: Bind
Species: Mu
Applications: Bind
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Mu
Applications: WB
Species: Mu
Applications: WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: EnzAct
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Rt
Applications: Bind
Species: Hu
Applications: IHC, Simple Western, WB
Species: Mu
Applications: Bind
Publications for EphA5 Antibody (H00002044-M04) (0)
There are no publications for EphA5 Antibody (H00002044-M04).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for EphA5 Antibody (H00002044-M04) (0)
There are no reviews for EphA5 Antibody (H00002044-M04).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for EphA5 Antibody (H00002044-M04) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional EphA5 Products
Bioinformatics Tool for EphA5 Antibody (H00002044-M04)
Discover related pathways, diseases and genes to EphA5 Antibody (H00002044-M04). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for EphA5 Antibody (H00002044-M04)
Discover more about diseases related to EphA5 Antibody (H00002044-M04).
| | Pathways for EphA5 Antibody (H00002044-M04)
View related products by pathway.
|
PTMs for EphA5 Antibody (H00002044-M04)
Learn more about PTMs related to EphA5 Antibody (H00002044-M04).
| | Research Areas for EphA5 Antibody (H00002044-M04)
Find related products by research area.
|
Blogs on EphA5