EphA5 Antibody (5C8)

Images

 
Western Blot: EphA5 Antibody (5C8) [H00002044-M04] - Detection against Immunogen (36.63 KDa) .

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
5C8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

EphA5 Antibody (5C8) Summary

Immunogen
EPHA5 (NP_004430, 234 a.a. ~ 333 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PSVVRHLAVFPDTITGADSSQLLEVSGSCVNHSVTDEPPKMHCSAEGEWLVPIGKCMCKAGYEEKNGTCQVCRPGFFKASPHIQSCGKCPPHSYTHEEAS
Specificity
EPHA5 - EPH receptor A5
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EPHA5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EphA5 Antibody (5C8)

  • Bsk
  • Cek7
  • EC 2.7.10
  • EC 2.7.10.1
  • Ehk1
  • EHK-1
  • EHK1Hek7
  • EK7
  • EPH homology kinase 1
  • Eph homology kinase-1
  • EPH receptor A5
  • EphA5
  • EPH-like kinase 7
  • ephrin type-A receptor 5
  • Hek7
  • receptor protein-tyrosine kinase HEK7
  • Rek7
  • TYRO4HEK7CEK7
  • tyrosine-protein kinase receptor EHK-1

Background

This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

374-EA
Species: Hu
Applications: Bind
AF3034
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
8415-A2
Species: Mu
Applications: BA
AF641
Species: Mu
Applications: IHC, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
359-EA
Species: Hu
Applications: Bind
NBP1-47839
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-47761
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
640-A3
Species: Mu
Applications: Bind
608-A7
Species: Mu
Applications: Bind
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
AF611
Species: Mu
Applications: WB
AF607
Species: Mu
Applications: WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
7570-GH
Species: Hu
Applications: EnzAct
AF454
Species: Mu
Applications: WB
NBP2-67327
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
1596-B1
Species: Rt
Applications: Bind
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
602-A1
Species: Mu
Applications: Bind

Publications for EphA5 Antibody (H00002044-M04) (0)

There are no publications for EphA5 Antibody (H00002044-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EphA5 Antibody (H00002044-M04) (0)

There are no reviews for EphA5 Antibody (H00002044-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EphA5 Antibody (H00002044-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EphA5 Products

Bioinformatics Tool for EphA5 Antibody (H00002044-M04)

Discover related pathways, diseases and genes to EphA5 Antibody (H00002044-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EphA5 Antibody (H00002044-M04)

Discover more about diseases related to EphA5 Antibody (H00002044-M04).
 

Pathways for EphA5 Antibody (H00002044-M04)

View related products by pathway.

PTMs for EphA5 Antibody (H00002044-M04)

Learn more about PTMs related to EphA5 Antibody (H00002044-M04).
 

Research Areas for EphA5 Antibody (H00002044-M04)

Find related products by research area.

Blogs on EphA5

There are no specific blogs for EphA5, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EphA5 Antibody (5C8) and receive a gift card or discount.

Bioinformatics

Gene Symbol EPHA5
Entrez
OMIM
Uniprot