Recombinant Human Epac2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Epac2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-110 of Human Epac2

Source: Wheat Germ

Amino Acid Sequence: MVAAHAAHSSSSAEWIACLDKRPLERSSEDVDIIFTRLKEVKAFEKFHPNLLHQICLCGYYENLEKGITLFRQGDIGTNWYAVLAGSLDVKVSETSSHQDAVTICTLGIG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
RAPGEF4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
37.73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Epac2 Protein

  • CAMP-GEFII
  • cAMP-regulated guanine nucleotide exchange factor II
  • CGEF2EPAC 2
  • EPAC2
  • Exchange factor directly activated by cAMP 2
  • Exchange protein directly activated by cAMP 2
  • Nbla00496
  • putative protein product of Nbla00496
  • Rap guanine nucleotide exchange factor (GEF) 4
  • rap guanine nucleotide exchange factor 4
  • RAP guanine-nucleotide-exchange factor (GEF) 4

Background

RAPGEF4 - Rap guanine nucleotide exchange factor (GEF) 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010411-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-22527
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-24574
Species: Hu, Mu, Ca, Ch, Eq, Op, Pm, Xp
Applications: WB, IHC-P
NBP1-76905
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for Epac2 Partial Recombinant Protein (H00011069-Q01) (0)

There are no publications for Epac2 Partial Recombinant Protein (H00011069-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Epac2 Partial Recombinant Protein (H00011069-Q01) (0)

There are no reviews for Epac2 Partial Recombinant Protein (H00011069-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Epac2 Partial Recombinant Protein (H00011069-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Epac2 Products

Bioinformatics Tool for Epac2 Partial Recombinant Protein (H00011069-Q01)

Discover related pathways, diseases and genes to Epac2 Partial Recombinant Protein (H00011069-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Epac2 Partial Recombinant Protein (H00011069-Q01)

Discover more about diseases related to Epac2 Partial Recombinant Protein (H00011069-Q01).
 

Pathways for Epac2 Partial Recombinant Protein (H00011069-Q01)

View related products by pathway.

PTMs for Epac2 Partial Recombinant Protein (H00011069-Q01)

Learn more about PTMs related to Epac2 Partial Recombinant Protein (H00011069-Q01).
 

Research Areas for Epac2 Partial Recombinant Protein (H00011069-Q01)

Find related products by research area.

Blogs on Epac2

There are no specific blogs for Epac2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Epac2 Antibody
NBP2-32009

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Epac2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RAPGEF4