Endophilin A1/SH3GL2 Antibody (2G6) - Azide and BSA Free

Western Blot: Endophilin A1/SH3GL2 Antibody (2G6) [H00006456-M06] - Analysis of SH3GL2 expression in PC-12 (Cat # L012V1).

Western Blot: Endophilin A1/SH3GL2 Antibody (2G6) [H00006456-M06] - Analysis of SH3GL2 expression in Hela S3 NE (Cat # L013V3).

ELISA: Endophilin A1/SH3GL2 Antibody (2G6) [H00006456-M06] - Detection limit for recombinant GST tagged SH3GL2 is approximately 3ng/ml as a capture antibody.

• Reactivity: Hu, Rt
• Applications: WB, ELISA
• Clone: 2G6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Endophilin A1/SH3GL2 Antibody (2G6) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: SH3GL2 (NP_003017, 64 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMREL
• Specificity: SH3GL2 - SH3-domain GRB2-like 2 (2G6)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SH3GL2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Endophilin A1/SH3GL2 Antibody (2G6) - Azide and BSA Free

• CNSA2
• CNSA2FLJ25015
• EEN-B1
• EEN-B1bA335L15.1 (SH3-domain GRB2-like 2)
• Endophilin A1
• Endophilin-1
• endophilin-A1
• FLJ20276
• SH3 domain protein 2A
• SH3 domain-containing GRB2-like protein 2
• SH3D2A
• SH3D2AEndophilin A1 BAR domain
• SH3-domain GRB2-like 2
• SH3GL2
• SH3P4
• SH3P4endophilin-1

Background

Implicated in synaptic vesicle endocytosis. May recruit other proteins to membranes with high curvature

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SH3GL2
• Entrez:
  • 6456(Human)
• Uniprot:
  • NP_003017(Human)