Recombinant Human EMR4P Protein

Images

 
SDS-Page: Recombinant Human EMR4P Protein [H00326342-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human EMR4P Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 21-93 of Human EMR4P

Source: Wheat Germ

Amino Acid Sequence: GSEAKNSGASCPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNKVGG

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ADGRE4P
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
33.77 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EMR4P Protein

  • egf-like module containing, mucin-like, hormone receptor-like 4 pseudogene
  • egf-like module containing, mucin-like, hormone receptor-like 4
  • Egf-tm7
  • EMR4
  • EMR4EGF-like module receptor 4
  • Fire
  • Gpr127
  • GPR127G-protein coupled receptor 127
  • G-protein coupled receptor PGR16
  • PGR16
  • PGR16G protein-coupled receptor 127

Background

EMR4 - egf-like module containing, mucin-like, hormone receptor-like 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75626
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5430
Species: Mu
Applications: WB, IP
H00054738-Q01
Species: Hu
H00347527-P01
Species: Hu
NB100-866
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
H00200576-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA
H00054922-B01P
Species: Hu, Mu
Applications: WB, ELISA
H00004810-M05
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-04611
Species: Hu
NBP1-89133
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1436
Species: Mu
Applications: WB
NBP2-15958
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4894
Species: Hu
Applications: WB, Neut
AF3734
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00326342-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for EMR4P Partial Recombinant Protein (H00326342-Q01) (0)

There are no publications for EMR4P Partial Recombinant Protein (H00326342-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EMR4P Partial Recombinant Protein (H00326342-Q01) (0)

There are no reviews for EMR4P Partial Recombinant Protein (H00326342-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EMR4P Partial Recombinant Protein (H00326342-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional EMR4P Products

Array H00326342-Q01

Bioinformatics Tool for EMR4P Partial Recombinant Protein (H00326342-Q01)

Discover related pathways, diseases and genes to EMR4P Partial Recombinant Protein (H00326342-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for EMR4P Partial Recombinant Protein (H00326342-Q01)

View related products by pathway.

Research Areas for EMR4P Partial Recombinant Protein (H00326342-Q01)

Find related products by research area.

Blogs on EMR4P

There are no specific blogs for EMR4P, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EMR4P Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ADGRE4P