EMC7 Antibody

Images

 
Western Blot: EMC7 Antibody [NBP1-88547] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: EMC7 Antibody [NBP1-88547] - Staining of human testis shows strong granular cytoplasmic positivity in leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EMC7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DMRREMEQSMNMLNSNHELPDVSEFMTRLFSSKSSGKSSSGSSKTGKSGAGK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EMC7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
EMC7 Protein (NBP1-88547PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EMC7 Antibody

  • C11orf3
  • C15orf24
  • chromosome 15 hypothetical ATG/GTP binding protein
  • chromosome 15 open reading frame 24
  • ER membrane protein complex subunit 7
  • HT022
  • ORF1-FL1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00057016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-31977
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89910
Species: Hu
Applications: IHC, IHC-P
NBP1-88838
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB4675
Species: Mu
Applications: WB, IHC, Neut
NBP1-82071
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15179
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-13618
Species: Hu
Applications: IHC, IHC-P
NBP2-14306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86769
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34951
Species: Hu
NBP2-38976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2699
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP1-85993
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-70775
Species: Hu, Po, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-88547
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for EMC7 Antibody (NBP1-88547) (0)

There are no publications for EMC7 Antibody (NBP1-88547).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EMC7 Antibody (NBP1-88547) (0)

There are no reviews for EMC7 Antibody (NBP1-88547). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EMC7 Antibody (NBP1-88547) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EMC7 Products

Bioinformatics Tool for EMC7 Antibody (NBP1-88547)

Discover related pathways, diseases and genes to EMC7 Antibody (NBP1-88547). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on EMC7

There are no specific blogs for EMC7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EMC7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EMC7