| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit ELOVL7 Antibody - BSA Free (NBP1-93926) is a polyclonal antibody validated for use in IHC and WB. Anti-ELOVL7 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MAFSDLTSRTVHLYDNWIKDADPRVEDWLLM |
| Predicted Species | Mouse (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ELOVL7 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-93926 | Applications | Species |
|---|---|---|
| Pusic KM, Kraig RP, Pusic AD IFN gamma -stimulated dendritic cell extracellular vesicles can be nasally administered to the brain and enter oligodendrocytes PloS one 2021-08-13 [PMID: 34388189] (WB, Rat) | WB | Rat |
Secondary Antibodies |
Isotype Controls |
Research Areas for ELOVL7 Antibody (NBP1-93926)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ELOVL7 |