ELL2 Antibody

Images

 
Western Blot: ELL2 Antibody [NBP1-69220] - ACHN cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ELL2 Antibody Summary

Immunogen
Synthetic peptides corresponding to ELL2 (elongation factor, RNA polymerase II, 2) The peptide sequence was selected from the C terminal of ELL2. Peptide sequence PGSKEYQNVHEEVLQEYQKIKQSSPNYHEEKYRCEYLHNKLAHIKRLIGE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ELL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ELL2 and was validated on Western blot.
Theoretical MW
72 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ELL2 Antibody

  • ELL-related RNA polymerase II, elongation factor
  • elongation factor, RNA polymerase II, 2
  • RNA polymerase II elongation factor ELL2

Background

ELL2 is the elongation factor that can increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by the polymerase at multiple sites along the DNA.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13955
Species: Hu
Applications: IHC, IHC-P
NBP1-88578
Species: Hu
Applications: WB, IHC, IHC-P
NB600-248
Species: Hu
Applications: WB, IP
NBP1-92002
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00027125-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-03982
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-82116
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00085403-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1566
Species: Hu
Applications: WB, IP
NBP1-84840
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-28728
Species: Hu
Applications: IP (-), WB, IHC
PP-H4537-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-496
Species: Hu
Applications: WB, IHC-P, IP
NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
NB100-1800
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P, IP
NBP1-97637
Species: Hu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC
NB120-10874
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-81215
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-69220
Species: Hu
Applications: WB

Publications for ELL2 Antibody (NBP1-69220) (0)

There are no publications for ELL2 Antibody (NBP1-69220).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELL2 Antibody (NBP1-69220) (0)

There are no reviews for ELL2 Antibody (NBP1-69220). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ELL2 Antibody (NBP1-69220) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ELL2 Products

Bioinformatics Tool for ELL2 Antibody (NBP1-69220)

Discover related pathways, diseases and genes to ELL2 Antibody (NBP1-69220). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ELL2 Antibody (NBP1-69220)

Discover more about diseases related to ELL2 Antibody (NBP1-69220).
 

Pathways for ELL2 Antibody (NBP1-69220)

View related products by pathway.

PTMs for ELL2 Antibody (NBP1-69220)

Learn more about PTMs related to ELL2 Antibody (NBP1-69220).

Blogs on ELL2

There are no specific blogs for ELL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ELL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ELL2
Uniprot