ELL2 Antibody


Western Blot: ELL2 Antibody [NBP1-69220] - ACHN cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

ELL2 Antibody Summary

Synthetic peptides corresponding to ELL2 (elongation factor, RNA polymerase II, 2) The peptide sequence was selected from the C terminal of ELL2. Peptide sequence PGSKEYQNVHEEVLQEYQKIKQSSPNYHEEKYRCEYLHNKLAHIKRLIGE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ELL2 and was validated on Western blot.
Theoretical MW
72 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
ELL2 Lysate (NBP2-65210)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ELL2 Antibody

  • ELL-related RNA polymerase II, elongation factor
  • elongation factor, RNA polymerase II, 2
  • RNA polymerase II elongation factor ELL2


ELL2 is the elongation factor that can increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by the polymerase at multiple sites along the DNA.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: IP (-), WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP, DirELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IB, ICC/IF, IHC-P, IP
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB

Publications for ELL2 Antibody (NBP1-69220) (0)

There are no publications for ELL2 Antibody (NBP1-69220).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELL2 Antibody (NBP1-69220) (0)

There are no reviews for ELL2 Antibody (NBP1-69220). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ELL2 Antibody (NBP1-69220) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for ELL2 Antibody (NBP1-69220)

Discover related pathways, diseases and genes to ELL2 Antibody (NBP1-69220). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ELL2 Antibody (NBP1-69220)

Discover more about diseases related to ELL2 Antibody (NBP1-69220).

Pathways for ELL2 Antibody (NBP1-69220)

View related products by pathway.

PTMs for ELL2 Antibody (NBP1-69220)

Learn more about PTMs related to ELL2 Antibody (NBP1-69220).

Blogs on ELL2

There are no specific blogs for ELL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ELL2 Antibody and receive a gift card or discount.


Gene Symbol ELL2