Elk-1 Antibody (2G6)

Images

 
Sandwich ELISA: Elk-1 Antibody (2G6) [H00002002-M01] - Detection limit for recombinant GST tagged ELK1 is approximately 1ng/ml as a capture antibody.
Proximity Ligation Assay: Elk-1 Antibody (2G6) [H00002002-M01] - Analysis of protein-protein interactions between MAPK3 and ELK1. HeLa cells were stained with anti-MAPK3 rabbit purified polyclonal 1:1200 and anti-ELK1 ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, PLA
Clone
2G6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Elk-1 Antibody (2G6) Summary

Immunogen
ELK1 (NP_005220 67 a.a. - 166 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQS
Specificity
ELK1 - ELK1, member of ETS oncogene family
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ELK1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.
Publications
Read Publication using H00002002-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Elk-1 Antibody (2G6)

  • Elk1
  • Elk-1
  • ELK1, member of ETS oncogene family
  • ETS domain-containing protein Elk-1
  • ETS-like gene 1

Background

This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is a nuclear target for the ras-raf-MAPK signaling cascade. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
PPS021
Species: Hu, Mu, Rt, Ca, Pm, Ze
Applications: WB
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87092
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC

Publications for Elk-1 Antibody (H00002002-M01)(1)

Reviews for Elk-1 Antibody (H00002002-M01) (0)

There are no reviews for Elk-1 Antibody (H00002002-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Elk-1 Antibody (H00002002-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Elk-1 Products

Bioinformatics Tool for Elk-1 Antibody (H00002002-M01)

Discover related pathways, diseases and genes to Elk-1 Antibody (H00002002-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Elk-1 Antibody (H00002002-M01)

Discover more about diseases related to Elk-1 Antibody (H00002002-M01).
 

Pathways for Elk-1 Antibody (H00002002-M01)

View related products by pathway.

PTMs for Elk-1 Antibody (H00002002-M01)

Learn more about PTMs related to Elk-1 Antibody (H00002002-M01).
 

Research Areas for Elk-1 Antibody (H00002002-M01)

Find related products by research area.

Blogs on Elk-1

There are no specific blogs for Elk-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Elk-1 Antibody (2G6) and receive a gift card or discount.

Bioinformatics

Gene Symbol ELK1
Entrez
OMIM
Uniprot