eIF2B3 Antibody [mFluor Violet 450 SE]

Product Discontinued

eIF2B3 Antibody [mFluor Violet 450 SE] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human eIF2B3 (NP_065098.1).
  
  Sequence:
  MEFQAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVVTTRDVQKALCAEFKMKMKPDIVCIPDDADMGTADSLRYIYPKLKTDVLVLSCDLITDVALHEVVDLFRAYDASLAMLMRKGQDSIEPVPGQKGKKKAVEQRDFIGVDSTGKRLLFMANEADLDEELVIKGSILQKHPRIRFHTGLVDAHLYCLKKYIVDFLMENGSITSIRSELIPYLVRKQFSSASSQQGQEEKEEDLKKKELKSLDIYSFIKEA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EIF2B3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for eIF2B3 Antibody [mFluor Violet 450 SE]

• eIF-2B GDP-GTP exchange factor subunit gamma
• EIF-2B
• EIF2Bgamma
• eukaryotic translation initiation factor 2B, subunit 3 (gamma, 58kD)
• eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa
• translation initiation factor eIF-2B subunit gamma

Background

The protein encoded by the eIF2B3 gene is one of the subunits of initiation factor eIF2B, which catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP. It has also been found to function as a cofactor of hepatitis C virus internal ribosome entry site-mediated translation. Mutations in this gene have been associated with leukodystrophy with vanishing white matter. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EIF2B3