EIF1A Antibody (2B8)

Images

 
Western Blot: EIF1A Antibody (2B8) [H00009086-M03] - Detection against Immunogen (35.64 KDa) .
Immunocytochemistry/ Immunofluorescence: EIF1A Antibody (2B8) [H00009086-M03] - Monoclonal antibody to EIF1AY on HeLa cell . [antibody concentration 10 ug/ml]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2B8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

EIF1A Antibody (2B8) Summary

Immunogen
EIF1AY (NP_004672, 31 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDT
Specificity
EIF1AY - eukaryotic translation initiation factor 1A, Y-linked (2B8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EIF1AX
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EIF1A Antibody (2B8)

  • eIF-1A
  • EIF1AP1
  • EIF4C
  • eIF-4C
  • eukaryotic translation initiation factor 1A, X chromosome
  • eukaryotic translation initiation factor 1A, X-chromosomal
  • eukaryotic translation initiation factor 1A, Y chromosome
  • eukaryotic translation initiation factor 1A, Y-chromosomal
  • Eukaryotic translation initiation factor 4C
  • FLJ45762
  • Putative eukaryotic translation initiation factor 1A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00702
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-03412
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-31528
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-16311
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-24529
Species: Ca, Ch, Hu, Mu, Pm
Applications: IHC, IHC-P, Simple Western, WB
NBP2-24632
Species: Ca, Ch, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NB100-268
Species: Hu, Po
Applications: IP, WB
NB100-81898
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37488
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67591
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-02669
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF2009
Species: Hu
Applications: ICC, IHC
AF7895
Species: Hu
Applications: IHC, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
H00008894-M09
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF5738
Species: Hu
Applications: ICC, KO, WB
NBP1-31113
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88376
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB

Publications for EIF1A Antibody (H00009086-M03) (0)

There are no publications for EIF1A Antibody (H00009086-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIF1A Antibody (H00009086-M03) (0)

There are no reviews for EIF1A Antibody (H00009086-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EIF1A Antibody (H00009086-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EIF1A Products

Array H00009086-M03

Bioinformatics Tool for EIF1A Antibody (H00009086-M03)

Discover related pathways, diseases and genes to EIF1A Antibody (H00009086-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EIF1A Antibody (H00009086-M03)

Discover more about diseases related to EIF1A Antibody (H00009086-M03).
 

Pathways for EIF1A Antibody (H00009086-M03)

View related products by pathway.

Blogs on EIF1A

There are no specific blogs for EIF1A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EIF1A Antibody (2B8) and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF1AX
Entrez
Uniprot