Recombinant Human EI24 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human EI24 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-340 of Human EI24 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MADSVKTFLQDLARGIKDSIWGICTISKLDARIQQKREEQRRRRASSVLAQRRAQSIERKQESEPRIVSRIFQCCAWNGGVFWFSLLLFYRVFIPVLQSVTARIIGDPSLHGDVWSWLEFFLTSIFSALWVLPLFVLSKVVNAIWFQDIADLAFEVSGRKPHPFPSVSKIIADMLFNLLLQALFLIQGMFVSLFPIHLVGQLVSLLHMSLLYSLYCFEYRWFNKGIEMHQRLSNIERNWPYYFGFGLPLAFLTAMQSSYIISGCLFSILFPLFIISANEAKTPGKAYLFQLRLFSLVVFLSNRLFHKTVYLQSALSSSTSAEKFPSPHPSPAKLKATSGH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
EI24

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EI24 Protein

  • EPG4
  • etoposide induced 2.4 mRNA
  • p53-induced gene 8 protein
  • PIG8etoposide-induced protein 2.4 homolog
  • TP53I8
  • tumor protein p53 inducible protein 8

Background

EI24( AAH02390, 1 a.a. - 341 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NBP2-02898
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF6897
Species: Hu, Mu
Applications: WB, IHC
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
AF5510
Species: Hu
Applications: WB
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00000900-B01P
Species: Hu
Applications: WB, ICC/IF
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-27972
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for EI24 Recombinant Protein (H00009538-P01) (0)

There are no publications for EI24 Recombinant Protein (H00009538-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EI24 Recombinant Protein (H00009538-P01) (0)

There are no reviews for EI24 Recombinant Protein (H00009538-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EI24 Recombinant Protein (H00009538-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EI24 Products

Bioinformatics Tool for EI24 Recombinant Protein (H00009538-P01)

Discover related pathways, diseases and genes to EI24 Recombinant Protein (H00009538-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EI24 Recombinant Protein (H00009538-P01)

Discover more about diseases related to EI24 Recombinant Protein (H00009538-P01).
 

Pathways for EI24 Recombinant Protein (H00009538-P01)

View related products by pathway.

PTMs for EI24 Recombinant Protein (H00009538-P01)

Learn more about PTMs related to EI24 Recombinant Protein (H00009538-P01).
 

Research Areas for EI24 Recombinant Protein (H00009538-P01)

Find related products by research area.

Blogs on EI24

There are no specific blogs for EI24, but you can read our latest blog posts.

Customers Who Bought This Also Bought

EI24 Antibody
NBP2-48993

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EI24 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EI24