EED Antibody

Images

 
Immunohistochemistry-Paraffin: EED Antibody [NBP2-38907] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: EED Antibody [NBP2-38907] - Staining of human tonsil shows strong nuclear positivity in germinal center cells.
Immunohistochemistry-Paraffin: EED Antibody [NBP2-38907] - Staining in human tonsil and pancreas tissues.. Corresponding EED RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: EED Antibody [NBP2-38907] - Staining of human pancreas shows no positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: EED Antibody [NBP2-38907] - Staining of human rectum shows moderate nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EED Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: HPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLK
Specificity
Specificity of human EED antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EED
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
EED Protein (NBP2-38907PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EED Antibody

  • EED
  • embryonic ectoderm development
  • HEED
  • polycomb protein EED
  • WAIT1
  • WAIT1
  • WAIT-1
  • WD protein associating with integrin cytoplasmic tails 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56313
Species: Hu
Applications: ICC/IF
NBP2-29965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
MAB4184
Species: Hu, Mu
Applications: WB, IP, ICC
NBP1-96140
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
H00006045-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-88856
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37370
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14217
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-46218
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
MAB41281
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF4478
Species: Hu
Applications: WB, IHC
H00005670-Q01
Species: Hu
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
NB100-56358
Species: Hu, Mu
Applications: WB

Publications for EED Antibody (NBP2-38907) (0)

There are no publications for EED Antibody (NBP2-38907).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EED Antibody (NBP2-38907) (0)

There are no reviews for EED Antibody (NBP2-38907). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for EED Antibody (NBP2-38907) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for EED Antibody (NBP2-38907)

Discover related pathways, diseases and genes to EED Antibody (NBP2-38907). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EED Antibody (NBP2-38907)

Discover more about diseases related to EED Antibody (NBP2-38907).
 

Pathways for EED Antibody (NBP2-38907)

View related products by pathway.

PTMs for EED Antibody (NBP2-38907)

Learn more about PTMs related to EED Antibody (NBP2-38907).

Blogs on EED.

EZH1 has more to offer than gene repression
EZH1 is part of the Polycomb-group family of proteins, which are responsible for remodeling chromatin in genes and modulating epigenetic silencing during development.  Specifically, EZHI is a component of PRC2, or polycomb repressive complex-2.  PR...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EED Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EED
Entrez
Uniprot