ECHS1 Antibody (3D8)

Images

 
There are currently no images for ECHS1 Antibody (H00001892-M09).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
3D8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ECHS1 Antibody (3D8) Summary

Immunogen
ECHS1 (AAH08906.1, 13 a.a. - 290 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GPLRPPVRCPAWRPFASGANFEYIIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKIFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHWDHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ECHS1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ECHS1 Antibody (3D8)

  • EC 4.2.1
  • enoyl CoA hydratase, short chain, 1, mitochondrial
  • enoyl Coenzyme A hydratase, short chain, 1, mitochondrial
  • Enoyl-CoA hydratase 1
  • enoyl-CoA hydratase, mitochondrial
  • SCEHEC 4.2.1.17
  • Short-chain enoyl-CoA hydratase

Background

The protein encoded by this gene functions in the second step of the mitochondrial fatty acid beta-oxidation pathway. It catalyzes the hydration of 2-trans-enoyl-coenzyme A (CoA) intermediates to L-3-hydroxyacyl-CoAs. The gene product is a member of the hydratase/isomerase superfamily. It localizes to the mitochondrial matrix. Transcript variants utilizing alternative transcription initiation sites have been described in the literature. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89290
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-84915
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03825
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-88364
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-16429
Species: Hu
NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-16700
Species: Hu, Mu
Applications: WB
NB100-56605
Species: Av, Bv, Sh
Applications: WB
H00051703-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-48549
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02118
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-59576
Species: Hu
Applications: WB, IHC
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-92431
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83215
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF3770
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-55460
Species: Hu
Applications: WB, ICC/IF
H00001892-M09
Species: Hu
Applications: ELISA

Publications for ECHS1 Antibody (H00001892-M09) (0)

There are no publications for ECHS1 Antibody (H00001892-M09).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ECHS1 Antibody (H00001892-M09) (0)

There are no reviews for ECHS1 Antibody (H00001892-M09). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ECHS1 Antibody (H00001892-M09) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ECHS1 Products

Bioinformatics Tool for ECHS1 Antibody (H00001892-M09)

Discover related pathways, diseases and genes to ECHS1 Antibody (H00001892-M09). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ECHS1 Antibody (H00001892-M09)

Discover more about diseases related to ECHS1 Antibody (H00001892-M09).
 

Pathways for ECHS1 Antibody (H00001892-M09)

View related products by pathway.

PTMs for ECHS1 Antibody (H00001892-M09)

Learn more about PTMs related to ECHS1 Antibody (H00001892-M09).
 

Research Areas for ECHS1 Antibody (H00001892-M09)

Find related products by research area.

Blogs on ECHS1

There are no specific blogs for ECHS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ECHS1 Antibody (3D8) and receive a gift card or discount.

Bioinformatics

Gene Symbol ECHS1
Uniprot