EBI2/GPR183 Antibody - BSA Free

Western Blot: EBI2/GPR183 Antibody [NBP2-86626] - WB Suggested Anti-GPR183 Antibody. Titration: 1.0 ug/ml. Positive Control: 293T Whole Cell

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

EBI2/GPR183 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human EBI2/GPR183. Peptide sequence: SLPWILLGACFIGYVLPLIIILICYSQICCKLFRTAKQNPLTEKSGVNKK The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPR183
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for EBI2/GPR183 Antibody - BSA Free

• EBI2
• EBI2Epstein-Barr virus induced gene 2 (lymphocyte-specific G protein-coupledreceptor)
• EBV-induced G-protein coupled receptor 2
• Epstein-Barr virus-induced G-protein coupled receptor 2
• G protein-coupled receptor 183
• GPR183
• G-protein coupled receptor 183

Background

EBI2 is an Orphan-A GPCR with an unknown ligand. It has a probable role as a mediator of EBV effects on B-lymphocyte and lymphoid tissues but not in T-lymphocyte or peripheral-blood T lymphocytes. EBI2 expression has been documented in B-lymphocyte cell lines and in lymphoid and pulmonary tissues. ESTs have been isolated from normal blood, breast, vessel, thymus, tonsil, lymph, ear, and fetal lung, testis, and B-cell libraries. ESTs have also been isolated from blood, bone marrow, breast, ear, ganglion, lung, lymph node, placenta, thymus, tonsil, and vessel cancer libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPR183