EBI2/GPR183 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human EBI2/GPR183. Peptide sequence: SLPWILLGACFIGYVLPLIIILICYSQICCKLFRTAKQNPLTEKSGVNKK The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GPR183 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for EBI2/GPR183 Antibody - BSA Free
Background
EBI2 is an Orphan-A GPCR with an unknown ligand. It has a probable role as a mediator of EBV effects on B-lymphocyte and lymphoid tissues but not in T-lymphocyte or peripheral-blood T lymphocytes. EBI2 expression has been documented in B-lymphocyte cell lines and in lymphoid and pulmonary tissues. ESTs have been isolated from normal blood, breast, vessel, thymus, tonsil, lymph, ear, and fetal lung, testis, and B-cell libraries. ESTs have also been isolated from blood, bone marrow, breast, ear, ganglion, lung, lymph node, placenta, thymus, tonsil, and vessel cancer libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-reported, Dual ISH-IHC, Flow, ICC, IHC, Neut
Species: Hu
Applications: ELISA, IHC, WB
Species: Mu
Applications: IHC, Neut, WB
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-reported, Flow, ICC, IHC, Neut
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, Neut, WB
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
Publications for EBI2/GPR183 Antibody (NBP2-86626) (0)
There are no publications for EBI2/GPR183 Antibody (NBP2-86626).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for EBI2/GPR183 Antibody (NBP2-86626) (0)
There are no reviews for EBI2/GPR183 Antibody (NBP2-86626).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for EBI2/GPR183 Antibody (NBP2-86626) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional EBI2/GPR183 Products
Research Areas for EBI2/GPR183 Antibody (NBP2-86626)
Find related products by research area.
|
Blogs on EBI2/GPR183