Ebf4 Antibody - Azide and BSA Free

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Ebf4 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit Ebf4 Antibody - Azide and BSA Free (NBP3-03953) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human EBF4 (NP_001103984.1). HFEKQPPSNLRKSNFFHFVLAMYDRQGQPVEVERTAFIDFVEKDREPGAEKTNNGIHYRLRLVYNNGLRTEQDLYVRLIDSMSKQAIIYEGQDKNPEMCRV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EBF4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for Ebf4 Antibody - Azide and BSA Free

• early B-cell factor 4
• EBF-4
• olf-1/EBF-like 4
• transcription factor COE4

Background

EBF4 belongs to the conserved Olf/EBF family of helix-loop-helix transcription factors, members of which play importantroles in neural development and B-cell maturation (Wang et al., 2002 (PubMed 12139918)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: EBF4