DZIP1L Antibody

Images

 
Immunohistochemistry-Paraffin: DZIP1L Antibody [NBP1-84030] - Staining of human bronchus shows strong nucleolar and membranous positivity in respiratory epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DZIP1L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LEDTLEEKLESMGIRKDAKGISIQTLRHLESLLRVQREQKARKFSEFLSLRGKLVKEVTSRAKERQENGAVVSQPDGQPSVKSQQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DZIP1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DZIP1L Protein (NBP1-84030PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DZIP1L Antibody

  • DAZ interacting protein 1-like
  • DAZ-interacting protein 1-like protein
  • DZIP2
  • FLJ32844
  • zinc finger protein DZIP1L

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
1705-HH/CF
Species: Hu, Mu
NBP2-31587
Species: Hu
Applications: IHC, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
H00064399-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NB100-1939
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
AF4078
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
H00002300-D01P
Species: Hu
Applications: WB
NBP1-87384
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84030
Species: Hu
Applications: IHC, IHC-P

Publications for DZIP1L Antibody (NBP1-84030) (0)

There are no publications for DZIP1L Antibody (NBP1-84030).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DZIP1L Antibody (NBP1-84030) (0)

There are no reviews for DZIP1L Antibody (NBP1-84030). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DZIP1L Antibody (NBP1-84030) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DZIP1L Products

Bioinformatics Tool for DZIP1L Antibody (NBP1-84030)

Discover related pathways, diseases and genes to DZIP1L Antibody (NBP1-84030). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DZIP1L Antibody (NBP1-84030)

Discover more about diseases related to DZIP1L Antibody (NBP1-84030).
 

Pathways for DZIP1L Antibody (NBP1-84030)

View related products by pathway.

PTMs for DZIP1L Antibody (NBP1-84030)

Learn more about PTMs related to DZIP1L Antibody (NBP1-84030).

Blogs on DZIP1L

There are no specific blogs for DZIP1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DZIP1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DZIP1L