dystrophia myotonica containing WD repeat motif Antibody (3F5) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
DMWD (AAH19266, 245 a.a. ~ 334 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GGEKPSGPVPRSRLDPAKVLGTALCPRIHEVPLLEPLVCKKIAQERLTVLLFLEDCIITACQEGLICTWARPGKAGISSQPGNSPSGTVV |
| Specificity |
DMWD - dystrophia myotonica-containing WD repeat motif |
| Isotype |
IgG1 Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
DMWD |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for dystrophia myotonica containing WD repeat motif Antibody (3F5) - Azide and BSA Free
Background
The gene that codes for DMWD (dystrophia myotonica WD-repeat containing protein) is located in the myotonic dystrophy (DM1) gene cluster on 19q. Mutations in the DM1 region affect DMPK (myotonic dystrophy protein kinase), a myosin kinase expressed in skeletal muscle, and are the cause of myotonic dystrophy, a form of muscular dystrophy characterized by wasting of the muscles and myotonia. DMWD is expressed ubiquitously and is most abundant in the testes and brain. Studies concerning its abundance and sub-cellular localization in brain tissue suggest that it may have a role in some of the mental symptoms associated with myotonic dystrophy. Alternate names for DMWD include DMR-N9, and DM9.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ChIP-EXO-SEQ, IHC, IHC-P
Species: Ca, Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Ba, Ca, Ch, Fi, Gp, Hu, Mu, Po, Pm, Rb, Rt, Sh
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC, IHC-P, IP, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB, ELISA
Publications for dystrophia myotonica containing WD repeat motif Antibody (H00001762-M01) (0)
There are no publications for dystrophia myotonica containing WD repeat motif Antibody (H00001762-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for dystrophia myotonica containing WD repeat motif Antibody (H00001762-M01) (0)
There are no reviews for dystrophia myotonica containing WD repeat motif Antibody (H00001762-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for dystrophia myotonica containing WD repeat motif Antibody (H00001762-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional dystrophia myotonica containing WD repeat motif Products
Research Areas for dystrophia myotonica containing WD repeat motif Antibody (H00001762-M01)
Find related products by research area.
|
Blogs on dystrophia myotonica containing WD repeat motif