dystrophia myotonica containing WD repeat motif Antibody (3F5) - Azide and BSA Free

Western Blot: dystrophia myotonica containing WD repeat motif Antibody (3F5) [H00001762-M01] - Analysis of DMWD expression in transfected 293T cell line by DMWD monoclonal antibody (M01), clone 3F5.Lane 1: DMWD transfected lysate (Predicted MW: 34.7 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3F5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

dystrophia myotonica containing WD repeat motif Antibody (3F5) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: DMWD (AAH19266, 245 a.a. ~ 334 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GGEKPSGPVPRSRLDPAKVLGTALCPRIHEVPLLEPLVCKKIAQERLTVLLFLEDCIITACQEGLICTWARPGKAGISSQPGNSPSGTVV
• Specificity: DMWD - dystrophia myotonica-containing WD repeat motif
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: DMWD
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for dystrophia myotonica containing WD repeat motif Antibody (3F5) - Azide and BSA Free

• D19S593E
• DM9
• DMRN9
• DMR-N9
• dystrophia myotonica WD repeat-containing protein
• dystrophia myotonica, WD repeat containing
• Dystrophia myotonica-containing WD repeat motif protein
• dystrophia myotonica-containing WD repeat motif
• gene59
• Protein 59
• Protein DMR-N9

Background

The gene that codes for DMWD (dystrophia myotonica WD-repeat containing protein) is located in the myotonic dystrophy (DM1) gene cluster on 19q. Mutations in the DM1 region affect DMPK (myotonic dystrophy protein kinase), a myosin kinase expressed in skeletal muscle, and are the cause of myotonic dystrophy, a form of muscular dystrophy characterized by wasting of the muscles and myotonia. DMWD is expressed ubiquitously and is most abundant in the testes and brain. Studies concerning its abundance and sub-cellular localization in brain tissue suggest that it may have a role in some of the mental symptoms associated with myotonic dystrophy. Alternate names for DMWD include DMR-N9, and DM9.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DMWD
• Entrez:
  • 1762(Human)
• OMIM:
  • 609857(Human)
• Uniprot:
  • AAH19266(Human)