DUSP12 Antibody

Images

 
Immunohistochemistry-Paraffin: DUSP12 Antibody [NBP1-84961] - Staining of human colon shows strong luminal membranous and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DUSP12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YQAMGYEVDTSSAIYKQYRLQKVTEKYPELQNLPQELFAVDPTTVSQGLKDEVLYKCRKCRRSLFRSSSILDHREGSGPIAFAHKRMTPSSMLTTGRQAQCTSYFIEPVQWMESALLGVMDGQLLCPKCSAKLGSFNWYGEQCSCGRWI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DUSP12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DUSP12 Protein (NBP1-84961PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DUSP12 Antibody

  • dual specificity phosphatase 12
  • dual specificity protein phosphatase 12
  • Dual specificity tyrosine phosphatase YVH1
  • DUSP1YVH1 protein-tyrosine phosphatase ortholog
  • EC 3.1.3.48
  • serine/threonine specific protein phosphatase
  • TDSP4
  • YVH1EC 3.1.3.16

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01340
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84961
Species: Hu
Applications: IHC, IHC-P

Publications for DUSP12 Antibody (NBP1-84961) (0)

There are no publications for DUSP12 Antibody (NBP1-84961).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DUSP12 Antibody (NBP1-84961) (0)

There are no reviews for DUSP12 Antibody (NBP1-84961). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DUSP12 Antibody (NBP1-84961) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DUSP12 Products

Bioinformatics Tool for DUSP12 Antibody (NBP1-84961)

Discover related pathways, diseases and genes to DUSP12 Antibody (NBP1-84961). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DUSP12 Antibody (NBP1-84961)

Discover more about diseases related to DUSP12 Antibody (NBP1-84961).
 

Pathways for DUSP12 Antibody (NBP1-84961)

View related products by pathway.

PTMs for DUSP12 Antibody (NBP1-84961)

Learn more about PTMs related to DUSP12 Antibody (NBP1-84961).
 

Research Areas for DUSP12 Antibody (NBP1-84961)

Find related products by research area.

Blogs on DUSP12

There are no specific blogs for DUSP12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DUSP12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DUSP12