DUSP11 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DUSP11 Antibody [NBP2-58109] - Staining of human cell line A-431 shows localization to nucleus, nucleoli fibrillar center & cytokinetic bridge.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DUSP11 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MSQWHHPRSGWGRRRDFSGRSSAKKKGGNHIPERWKDYLPVGQRMPGTRFIAFKVPLQKSFEKKLAPEECFSPLDLFNKIREQNEELGLIIDLTYTQRYYKPEDLPETVPYLKIFTVGHQVPDDETIFKFKHAVNGFLKENKDNDKLIGV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DUSP11
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DUSP11 Recombinant Protein Antigen (NBP2-58109PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for DUSP11 Antibody

  • dual specificity phosphatase 11 (RNA/RNP complex 1-interacting)
  • Dual specificity protein phosphatase 11
  • EC 3.1.3.-
  • Phosphatase that interacts with RNA/RNP complex 1
  • PIR1RNA/RNP complex-interacting phosphatase
  • RNA/RNP complex-1-interacting phosphatase
  • serine/threonine specific protein phosphatase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02128
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83269
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88924
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-68133
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
MAB4457
Species: Hu, Mu, Rt
Applications: WB
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP2-57026
Species: Hu
Applications: ICC/IF
NBP1-81162
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-14424
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24727
Species: Hu, Mu, Ca
Applications: WB, ICC/IF
MAB1654
Species: Hu, Mu, Rt
Applications: WB
NBP2-58109
Species: Hu
Applications: ICC/IF

Publications for DUSP11 Antibody (NBP2-58109) (0)

There are no publications for DUSP11 Antibody (NBP2-58109).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DUSP11 Antibody (NBP2-58109) (0)

There are no reviews for DUSP11 Antibody (NBP2-58109). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DUSP11 Antibody (NBP2-58109) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DUSP11 Products

Bioinformatics Tool for DUSP11 Antibody (NBP2-58109)

Discover related pathways, diseases and genes to DUSP11 Antibody (NBP2-58109). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DUSP11 Antibody (NBP2-58109)

Discover more about diseases related to DUSP11 Antibody (NBP2-58109).
 

Pathways for DUSP11 Antibody (NBP2-58109)

View related products by pathway.

PTMs for DUSP11 Antibody (NBP2-58109)

Learn more about PTMs related to DUSP11 Antibody (NBP2-58109).

Blogs on DUSP11

There are no specific blogs for DUSP11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DUSP11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DUSP11