C12orf56 Antibody

Images

 
Immunohistochemistry-Paraffin: C12orf56 Antibody [NBP2-30788] - Staining of human testis shows moderate positivity in nucleoli in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: C12orf56 Antibody [NBP2-30788] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C12orf56 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RSLKESILRDQQESSTPSKDSTLCPRPGLKKLSLHGQGAFRPLPSPSRRSSQSAPTTGKAVSEPSCTTNTKEPQGLPDHNSIS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C12orf56
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
C12orf56 Protein (NBP2-30788PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C12orf56 Antibody

  • Chromosome 12 Open Reading Frame 56
  • Uncharacterized Protein C12orf56

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58397
Species: Hu
Applications: WB, ICC/IF
NBP1-57176
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-90998
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01671
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB4696
Species: Hu, Rt
Applications: WB, IHC
NB100-56705
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB500-248
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89425
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005076-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-30788
Species: Hu
Applications: IHC, IHC-P

Publications for C12orf56 Antibody (NBP2-30788) (0)

There are no publications for C12orf56 Antibody (NBP2-30788).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C12orf56 Antibody (NBP2-30788) (0)

There are no reviews for C12orf56 Antibody (NBP2-30788). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for C12orf56 Antibody (NBP2-30788) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C12orf56 Products

C12orf56 NBP2-30788

Bioinformatics Tool for C12orf56 Antibody (NBP2-30788)

Discover related pathways, diseases and genes to C12orf56 Antibody (NBP2-30788). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C12orf56 Antibody (NBP2-30788)

Discover more about diseases related to C12orf56 Antibody (NBP2-30788).

Blogs on C12orf56

There are no specific blogs for C12orf56, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C12orf56 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C12orf56
Uniprot