Drebrin 1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DBN1. Source: E.coli
Amino Acid Sequence: CACASHVAKVAEFFQGVDVIVNASSVEDIDAGAIGQRLSNGLARLSSPVLHRLRLREDENAEPVGTTYQKTDAAVEMKRINREQFWEQ |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
DBN1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This peptide is useful as a blocking peptide for NBP2-38813.Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.For further blocking peptide related information and a protocol, click here. |
| Theoretical MW |
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Alternate Names for Drebrin 1 Recombinant Protein Antigen
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
Species: Hu
Applications: AC
Publications for Drebrin 1 Protein (NBP2-38813PEP) (0)
There are no publications for Drebrin 1 Protein (NBP2-38813PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Drebrin 1 Protein (NBP2-38813PEP) (0)
There are no reviews for Drebrin 1 Protein (NBP2-38813PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Drebrin 1 Protein (NBP2-38813PEP) (0)
Other Available Formats
Additional Drebrin 1 Products
Bioinformatics Tool for Drebrin 1 Protein (NBP2-38813PEP)
Discover related pathways, diseases and genes to Drebrin 1 Protein (NBP2-38813PEP). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Drebrin 1 Protein (NBP2-38813PEP)
Discover more about diseases related to Drebrin 1 Protein (NBP2-38813PEP).
| | Pathways for Drebrin 1 Protein (NBP2-38813PEP)
View related products by pathway.
|
Research Areas for Drebrin 1 Protein (NBP2-38813PEP)
Find related products by research area.
|
Blogs on Drebrin 1
![Western Blot: Synaptophysin Antibody [NB300-653] - Approximate MW of Synaptophysin is 39kDa.](http://images.novusbio.com/images2/Synaptophysin-Antibody-Western-Blot-NB300-653-img0001.jpg)
![Immunohistochemistry-Frozen: Synaptophysin Antibody [NB300-653] - Feline retina. Synaptophysin (green), DAPI (blue). The image was capture by epifluorescent microscopy. Image from verified customer review.](http://images.novusbio.com/images2/Synaptophysin-Antibody-Immunohistochemistry-Frozen-NB300-653-img0006.jpg)
![Immunohistochemistry-Paraffin: Synaptophysin Antibody [NB300-653] - Rat brain, 1:100 dilution.](http://images.novusbio.com/images2/Synaptophysin-Antibody-Immunohistochemistry-Paraffin-NB300-653-img0002.jpg)
![Western Blot: Destrin Antibody (2F7) [NBP2-00527] Analysis of extracts (35ug) from 9 different cell lines by using anti-Destrin monoclonal antibody.](http://images.novusbio.com/images/Destrin Antibody (2F7)-Western Blot-NBP2-00527-img0016.jpg)
![Immunocytochemistry/Immunofluorescence: Destrin Antibody (2F7) [NBP2-00527] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Destrin.](http://images.novusbio.com/images/Destrin Antibody (2F7)-Immunocytochemistry-Immunofluorescence-NBP2-00527-img0015.jpg)
![Immunohistochemistry-Paraffin: Destrin Antibody (2F7) [NBP2-00527] - Staining of paraffin-embedded Human prostate tissue using anti-Destrin mouse monoclonal antibody.](http://images.novusbio.com/images/Destrin Antibody (2F7)-Immunohistochemistry-Paraffin-NBP2-00527-img0014.jpg)
![Immunohistochemistry: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - IHC analysis of beta Amyloid on normal mouse brain (left) and 5xFAD mouse brain (right) using DAB with hematoxylin counterstain. The MOAB-2 antibody was used at 1:20 on normal mouse brain and at 1:400 on 5xFAD mouse brain.](http://images.novusbio.com/images2/beta-Amyloid-Antibody-(MOAB-2)-Immunohistochemistry-NBP2-13075-img0014.jpg)
![Western Blot: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Analysis of beta Amyloid (MOAB-2) antibody in (1) 100 pmole beta Amyloid 42, (2) 5xFAD mouse brain homogenate Repetition 1 and (3) 5xFAD mouse brain homogenate Repetition 2.](http://images.novusbio.com/images2/beta-Amyloid-Antibody-(MOAB-2)-Western-Blot-NBP2-13075-img0017.jpg)
![Western Blot: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Western blot analysis in cell lysates from HEK-APP SWE/BACE1 cells probed with an antibody against the C-terminus of APP (Lanes 1 and 2) and beta Amyloid (MOAB-2, Lanes 3 and 4). Beta Amyloid (MOAB-2) does not detect APP (from PMID: 22423893).](http://images.novusbio.com/images2/beta-Amyloid-Antibody-(MOAB-2)-Western-Blot-NBP2-13075-img0016.jpg)
![Western Blot: PSD-95 Antibody (6G6-1C9) [NB300-556] - Analysis of 25 ug of mouse brain (lane 1) and rat brain (lane 2) cell lysates.](http://images.novusbio.com/images2/PSD-95-Antibody-(6G6-1C9)-Western-Blot-NB300-556-img0020.jpg)
![Immunocytochemistry/Immunofluorescence: PSD-95 Antibody (6G6-1C9) [NB300-556] - Control immunolocalization of plasma membrane AMPA receptor subunits (external epitopes) in hippocampal neuronal cultures. H) Immunolabeling of non-permeabilized neuronal cultures with ani-GluA1 (green). (I) Immunolabeling with the postsynaptic marker anti-PSD95 [66] after permeabilization of neuronal cultures. (J) Merging of (H) and (I) showing postsynaptic labeling of GluA1. Scale bar (valid for all images): 10 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0140868), licensed under a CC-BY licence.](http://images.novusbio.com/images2/PSD-95 Antibody (6G6-1C9)-Immunocytochemistry-Immunofluorescence-NB300-556-img0025.jpg)
![Immunohistochemistry-Paraffin: PSD-95 Antibody (6G6-1C9) [NB300-556] - Confocal images of dissociated hippocampal cultures. Double labeling with anti-syntaxin-1 Double labeling with antibodies against syntaxin-1 (D) and synaptophysin (E) indicates that syntaxin-1 is colocalized with presynaptic marker (F). Image collected and cropped by CiteAb from the following publication (http://journal.frontiersin.org/Article/10.3389/fnmol.2016.00010/abstract), licensed under a CC-BY licence.](http://images.novusbio.com/images2/PSD-95-Antibody-(6G6-1C9)-Immunohistochemistry-Paraffin-NB300-556-img0024.jpg)
![Western Blot: HIP-55 Antibody [NBP1-91988] - Analysis using Anti-DBNL antibody NBP1-91988 (A) shows similar pattern to independent antibody NBP1-91989 (B).](http://images.novusbio.com/images2/HIP-55-Antibody-Western-Blot-NBP1-91988-img0011.jpg)
![Immunohistochemistry-Paraffin: HIP-55 Antibody [NBP1-91988] - Staining of human testis.](http://images.novusbio.com/images2/HIP-55 Antibody-Immunohistochemistry-Paraffin-NBP1-91988-img0013.jpg)
![Western Blot: HIP-55 Antibody [NBP1-91988] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/images2/HIP-55-Antibody-Western-Blot-NBP1-91988-img0006.jpg)
![Western Blot: SNAP25 Antibody [NBP1-88769] - Analysis in mouse cerebral cortex tissue.](http://images.novusbio.com/images2/SNAP25 Antibody-Western Blot-NBP1-88769-img0025.jpg)
![Immunohistochemistry-Paraffin: SNAP25 Antibody [NBP1-88769] - Analysis in human cerebral cortex and testis tissues using NBP1-88769 antibody. Corresponding SNAP25 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/SNAP25-Antibody-Immunohistochemistry-Paraffin-NBP1-88769-img0024.jpg)
![Western Blot: SNAP25 Antibody [NBP1-88769] - Analysis in human cell lines U2OS and MCF-7 using anti-SNAP25 antibody. Corresponding SNAP25 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.](http://images.novusbio.com/images2/SNAP25-Antibody-Western-Blot-NBP1-88769-img0017.jpg)
![Immunocytochemistry/Immunofluorescence: MAP2 Antibody [NB300-213] - Mouse primary cultures stained with MAP2 antibody. Image from verified customer review.](http://images.novusbio.com/images2/MAP2-Antibody-Immunocytochemistry-Immunofluorescence-NB300-213-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: MAP2 Antibody [NB300-213] - Immunofluorescent analysis of cortical neuron-glial cell culture from E20 rat stained with chicken pAb to microtubule associated protein 2 (MAP2), NB300-213, dilution 1:10,000 in red, and mouse mAb to MAP-tau, NPB2-25162, dilution 1:2,000, in green. The blue is DAPI staining of nuclear DNA. NB300-213 antibody stains dendrites and perikarya of neurons, while NBP2-25162 antibody labels neuronal perikarya, dendrites and also axonal process. As a result perikarya and dendrites appears orange-yellow, since they contain both MAP2 and tau, while axons are green.](http://images.novusbio.com/images2/MAP2-Antibody-Immunocytochemistry-Immunofluorescence-NB300-213-img0006.jpg)
![Western Blot: MAP2 Antibody [NB300-213] - Western blot analysis of whole brain tissue lysates using chicken pAb to microtubule associated protein 2 (MAP2), NB300-213, dilution 1:50,000 in green: [1] protein standard (red), [2] adult rat brain, [3] embryonic E20 rat brain, [4] adult mouse brain. Strong band observed at ~280kDa mark corresponds to two major isoforms of MAP2 protein referred to as MAP2A and MAP2B. Smaller fragments of these isoforms are also detected if the antibody is used at higher concentrations.](http://images.novusbio.com/images2/MAP2-Antibody-Western-Blot-NB300-213-img0005.jpg)
![Western Blot: DBT Antibody [NBP1-89522] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/images2/DBT-Antibody-Western-Blot-NBP1-89522-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: DBT Antibody [NBP1-89522] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/images2/DBT-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89522-img0007.jpg)
![Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining of human colon.](http://images.novusbio.com/images2/DBT-Antibody-Immunohistochemistry-Paraffin-NBP1-89522-img0015.jpg)
![Western Blot: Gelsolin/GSN Antibody [NBP1-33177] - Non-transfected (-) and transfected (+) HeLa whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with Gelsolin antibody [C2C3], C-term.](http://images.novusbio.com/images2/Gelsolin-GSN-Antibody-Western-Blot-NBP1-33177-img0016.jpg)
![Immunocytochemistry/Immunofluorescence: Gelsolin/GSN Antibody [NBP1-33177] - Methanol-fixed HeLa, using Gelsolin antibody (Green) at 1:500 dilution. Alpha-tubulin filaments were labeled with Red at 1:2000.](http://images.novusbio.com/images2/Gelsolin-GSN-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-33177-img0008.jpg)
![Immunohistochemistry-Paraffin: Gelsolin/GSN Antibody [NBP1-33177] - H1299 xenograft, using Gelsolin antibody at 1:500 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min](http://images.novusbio.com/images2/Gelsolin-GSN-Antibody-Immunohistochemistry-Paraffin-NBP1-33177-img0009.jpg)
![Western Blot: Tau [p Thr181] Antibody [NB100-82245] - Analysis of extracts from mouse brain tissue using Tau(Phospho-Thr181) Antibody and the same antibody preincubated with blocking peptide.](http://images.novusbio.com/images2/Tau [p Thr181] Antibody-Western Blot-NB100-82245-img0001.jpg)
![Immunohistochemistry-Paraffin: Tau [p Thr181] Antibody [NB100-82245] - analysis of paraffin-embedded rat hippocampal region tissue from a model with Alzheimer's Disease using Tau (phospho-Thr181) antibody.](http://images.novusbio.com/images2/Tau-[p-Thr181]-Antibody-Immunohistochemistry-Paraffin-NB100-82245-img0005.jpg)
![Western Blot: Tau [p Thr181] Antibody [NB100-82245] - Western blot analysis of extract from mouse brain tissue using Tau (Ab-181) antibody ( Lane 1 and 2) and Tau (phospho-Thr181) antibody ( Lane 3 and 4).](http://images.novusbio.com/images2/Tau [p Thr181] Antibody-Western Blot-NB100-82245-img0003.jpg)
![Western Blot: Methionine Aminopeptidase 2/METAP2 Antibody (JG39-79) [NBP2-80467] - Analysis of Methionine Aminopeptidase 2/METAP2/METAP2 on Hela cell using anti-Methionine Aminopeptidase 2/METAP2/METAP2 antibody at 1/1,000 dilution. Positive control: Lane 1: Daudi Lane 2: K562 Lane 3: Mouse thymus Lane 4: Mouse kidney](http://images.novusbio.com/images2/Methionine Aminopeptidase 2-METAP2 Antibody (JG39-79)-Western Blot-NBP2-80467-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: Methionine Aminopeptidase 2/METAP2 Antibody (JG39-79) [NBP2-80467] - Staining Methionine Aminopeptidase 2 in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilized with 0.25% Triton X100/PBS.](http://images.novusbio.com/images2/Methionine-Aminopeptidase-2-METAP2-Antibody-(JG39-79)-Immunocytochemistry-Immunofluorescence-NBP2-80467-img0004.jpg)
![Immunohistochemistry-Paraffin: Methionine Aminopeptidase 2/METAP2 Antibody (JG39-79) [NBP2-80467] - Analysis in mouse testis tissue using Methionine Aminopeptidase 2/METAP2/METAP2 antibody. Counter stained with hematoxylin.](http://images.novusbio.com/images2/Methionine-Aminopeptidase-2-METAP2-Antibody-(JG39-79)-Immunohistochemistry-Paraffin-NBP2-80467-img0009.jpg)
![Western Blot: FLAD1 Antibody [NBP1-84752] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/images2/FLAD1-Antibody-Western-Blot-NBP1-84752-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: FLAD1 Antibody [NBP1-84752] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.](http://images.novusbio.com/images2/FLAD1 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84752-img0007.jpg)
![Immunohistochemistry-Paraffin: FLAD1 Antibody [NBP1-84752] - Staining of human duodenum shows cytoplasmic positivity in glandular cells.](http://images.novusbio.com/images2/FLAD1-Antibody-Immunohistochemistry-Paraffin-NBP1-84752-img0002.jpg)
![Western Blot: TEF1 Antibody [NBP2-94035] - Analysis of extracts of various cell lines, using TEF1 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 120s.](http://images.novusbio.com/images2/TEF1-Antibody-Western-Blot-NBP2-94035-img0009.jpg)
![Immunocytochemistry/Immunofluorescence: TEF1 Antibody [NBP2-94035] - Analysis of extracts of HeLa cell line, using TEF1 rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.](http://images.novusbio.com/images2/TEF1 Antibody-Immunocytochemistry-Immunofluorescence-NBP2-94035-img0010.jpg)
![Immunohistochemistry-Paraffin: TEF1 Antibody [NBP2-94035] - Paraffin-embedded mouse lung using TEF1.](http://images.novusbio.com/images2/TEF1-Antibody-Immunohistochemistry-Paraffin-NBP2-94035-img0008.jpg)
![Western Blot: EGR1 Antibody (6E8) [H00001958-M03] - EGR1 monoclonal antibody (M03), clone 6E8. Western Blot analysis of EGR1 expression in PC-12.](http://images.novusbio.com/images2/EGR1-Antibody-(6E8)-Western-Blot-H00001958-M03-img0013.jpg)
![Immunocytochemistry/Immunofluorescence: EGR1 Antibody (6E8) [H00001958-M03] - Analysis of monoclonal antibody to EGR1 on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/images2/EGR1-Antibody-(6E8)-Immunocytochemistry-Immunofluorescence-H00001958-M03-img0010.jpg)
![Immunohistochemistry-Paraffin: EGR1 Antibody (6E8) [H00001958-M03] - Analysis of monoclonal antibody to EGR1 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml](http://images.novusbio.com/images2/EGR1-Antibody-(6E8)-Immunohistochemistry-Paraffin-H00001958-M03-img0011.jpg)
![Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p16INK4a/CDKN2A in (A) NIH/3T3 and (B) MEF cells.](http://images.novusbio.com/images2/p16INK4a-CDKN2A-Antibody-Western-Blot-NB200-106-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).](http://images.novusbio.com/images2/p19ARF-Antibody-Immunocytochemistry-Immunofluorescence-NB200-106-img0004.jpg)
![Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.](http://images.novusbio.com/images2/p19ARF-Antibody-Immunocytochemistry-Immunofluorescence-NB200-106-img0006.jpg)
