DPYS Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

DPYS Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DPYS
  
  

  Source: E.coli

  Amino Acid Sequence: THYWKKEWHHAAHHVMGPPLRPDPSTPDFLMNLLANDDLTTTGTDNCTFNNCQKAL

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: DPYS
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24800It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DPYS Recombinant Protein Antigen

• DHPasehydantoinase
• DHPHydantoinase
• dihydropyrimidinase
• Dihydropyrimidine amidohydrolase
• EC 3.5.2.2

Background

DPYS, also known as Dihydropyrimidinase, is a 56.6 kDa, 519 amino acid protein that is involved in catalyzing the reaction of 5,6-dihydrouracil in to 3-ureidopropionate in the second step of pyrimidine reduction and degradation. Diseases and disorders such as pneumonia, beriberi, convulsions, carcinoma, neuronitis, tuberculosis, dihydropyrimidinuria, gastric cancer, and papillon-lefevre disease have been studied with this protein. The protein interacts in pyrimidine metabolism, beta-alanine metabolism, thymine degradation, and drug metabolism pathways with DPYD, UPB1, and DPYSL5.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DPYS