DPYS Antibody [DyLight 405]

Product Discontinued

DPYS Antibody [DyLight 405] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 250-519 of human DPYS (NP_001376.1).
  
  Sequence:
  MSKSAAKVIADARRDGKVVYGEPIAASLGTDGTHYWNKEWHHAAHHVMGPPLRPDPSTPDFLMNLLANDDLTTTGTDNCTFNTCQKALGKDDFTKIPNGVNGVEDRMSVIWEKGVHSGKMDENRFVAVTSTNAAKIFNLYPRKGRIAVGSDADIVIWDPKGTRTISAKTHHQAVNFNIFEGMVCHGVPLVTISRGKVVYEAGVFSVTAGDGKFIPRKPFAEYIYKRIKQRDRTCTPTPVERAPYKGEVATLKSRVTKEDATAGTRKQAHP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DPYS
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for DPYS Antibody [DyLight 405]

• DHPasehydantoinase
• DHPHydantoinase
• dihydropyrimidinase
• Dihydropyrimidine amidohydrolase
• EC 3.5.2.2

Background

DPYS, also known as Dihydropyrimidinase, is a 56.6 kDa, 519 amino acid protein that is involved in catalyzing the reaction of 5,6-dihydrouracil in to 3-ureidopropionate in the second step of pyrimidine reduction and degradation. Diseases and disorders such as pneumonia, beriberi, convulsions, carcinoma, neuronitis, tuberculosis, dihydropyrimidinuria, gastric cancer, and papillon-lefevre disease have been studied with this protein. The protein interacts in pyrimidine metabolism, beta-alanine metabolism, thymine degradation, and drug metabolism pathways with DPYD, UPB1, and DPYSL5.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DPYS