DPP8 Antibody - BSA Free

Western Blot: DPP8 Antibody [NBP3-38387] - Western blot analysis of various lysates using DPP8 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DPP8 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DPP8 Antibody - BSA Free (NBP3-38387) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 10-230 of human DPP8 (NP_932065.1).
  
  Sequence:
  IKSGKCNMAAAMETEQLGVEIFETADCEENIESQDRPKLEPFYVERYSWSQLKKLLADTRKYHGYMMAKAPHDFMFVKRNDPDGPHSDRIYYLAMSGENRENTLFYSEIPKTINRAAVLMLSWKPLLDLFQATLDYGMYSREEELLRERKRIGTVGIASYDYHQGSGTFLFQAGSGIYHVKDGGPQGFTQQPLRPNLVETSCPNIRMDPKLCPADPDWIAF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DPP8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 103 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DPP8 Antibody - BSA Free

• dipeptidyl peptidase 8
• Dipeptidyl peptidase IV-related protein 1
• dipeptidyl peptidase IV-related protein-1
• dipeptidylpeptidase 8
• dipeptidyl-peptidase 8
• DP8
• DP8Dipeptidyl peptidase VIII
• DPP VIII
• DPP8
• DPRP1
• DPRP-1
• DPRP1Prolyl dipeptidase DPP8
• EC 3.4.14.5
• FLJ14920
• FLJ20283
• MGC26191
• MSTP097
• MSTP135
• MSTP141

Background

DPP8 encodes a member of the peptidase S9B family, a small family of dipeptidyl peptidases that are able to cleave peptide substrates at a prolyl bond. The encoded protein shares similarity with dipeptidyl peptidase IV in that it is ubiquitously expressed, and hydrolyzes the same substrates. These similarities suggest that, like dipeptidyl peptidase IV, this protein may play a role in T-cell activation and immune function. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DPP8