DPM1 Antibody

Images

 
Immunohistochemistry-Paraffin: DPM1 Antibody [NBP2-13935] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DPM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SLEVSRSPRRSRRELEVRSPRQNKYSVLLPTYNERENLPLIVWLLVKSFS ESGINYEIIIIDDGSPDGTRDVAEQLEKIYGSD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DPM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DPM1 Protein (NBP2-13935PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DPM1 Antibody

  • CDGIEEC 2.4.1.83
  • dolichol monophosphate mannose synthase
  • dolichol-phosphate mannosyltransferase
  • Dolichyl-phosphate beta-D-mannosyltransferase
  • dolichyl-phosphate mannosyltransferase polypeptide 1, catalytic subunit
  • DPM synthase
  • Mannose-P-dolichol synthase
  • MPD synthase
  • MPDSDolichol-phosphate mannose synthase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38056
Species: Hu
Applications: IHC, IHC-P
NBP1-81216
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84570
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87692
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32539
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30375
Species: Hu
Applications: IHC, IHC-P
NBP2-14246
Species: Hu
Applications: IHC, IHC-P
NB500-330
Species: Hu
Applications: B/N, Flow, IHC, IHC-P, IP, CyTOF-ready
NBP1-62494
Species: Hu
Applications: WB
46780002
Species: Hu
Applications: ELISA
H00022845-G01-10ug
Species: Hu
NBP2-13760
Species: Hu
Applications: IHC, IHC-P
NBP1-47914
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85699
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82845
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DPM1 Antibody (NBP2-13935) (0)

There are no publications for DPM1 Antibody (NBP2-13935).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPM1 Antibody (NBP2-13935) (0)

There are no reviews for DPM1 Antibody (NBP2-13935). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DPM1 Antibody (NBP2-13935) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DPM1 Products

Bioinformatics Tool for DPM1 Antibody (NBP2-13935)

Discover related pathways, diseases and genes to DPM1 Antibody (NBP2-13935). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DPM1 Antibody (NBP2-13935)

Discover more about diseases related to DPM1 Antibody (NBP2-13935).
 

Pathways for DPM1 Antibody (NBP2-13935)

View related products by pathway.

PTMs for DPM1 Antibody (NBP2-13935)

Learn more about PTMs related to DPM1 Antibody (NBP2-13935).

Blogs on DPM1

There are no specific blogs for DPM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DPM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DPM1