DOK4 Antibody

Images

 
Western Blot: DOK4 Antibody [NBP2-82902] - WB Suggested Anti-DOK4 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human heart

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DOK4 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human DOK4. Peptide sequence: GSQNIAEASSYAGEGYGAAQASSETDLLNRFILLKPKPSQGDSSEAKTPS The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
DOK4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DOK4 Antibody

  • docking protein 4
  • Downstream of tyrosine kinase 4
  • FLJ10488
  • Insulin receptor substrate 5
  • IRS5
  • IRS-5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1463
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NB100-1343
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NB100-82112
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-45435
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-12793
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
AF482
Species: Mu
Applications: IHC, WB
NBP3-12966
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-75585
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NB500-517
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-59451
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, WB
AF5094
Species: Hu, Mu, Rt
Applications: WB
AF6347
Species: Hu
Applications: WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP1-80507
Species: Hu
Applications: WB
NBP2-82902
Species: Hu
Applications: WB

Publications for DOK4 Antibody (NBP2-82902) (0)

There are no publications for DOK4 Antibody (NBP2-82902).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DOK4 Antibody (NBP2-82902) (0)

There are no reviews for DOK4 Antibody (NBP2-82902). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DOK4 Antibody (NBP2-82902) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DOK4 Products

Bioinformatics Tool for DOK4 Antibody (NBP2-82902)

Discover related pathways, diseases and genes to DOK4 Antibody (NBP2-82902). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DOK4 Antibody (NBP2-82902)

Discover more about diseases related to DOK4 Antibody (NBP2-82902).
 

Pathways for DOK4 Antibody (NBP2-82902)

View related products by pathway.

PTMs for DOK4 Antibody (NBP2-82902)

Learn more about PTMs related to DOK4 Antibody (NBP2-82902).
 

Research Areas for DOK4 Antibody (NBP2-82902)

Find related products by research area.

Blogs on DOK4

There are no specific blogs for DOK4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DOK4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DOK4