DOG1/TMEM16A Antibody (DG1/447 + DOG-1.1) [Janelia Fluor® 549] Summary
| Immunogen |
Recombinant human canine-1 protein (DG1/447) + A synthetic peptide from human canine-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1). (Uniprot: Q5XX6) |
| Localization |
Cell Surface and Cytoplasmic |
| Marker |
Marker for Gastrointestinal Stromal Tumors |
| Isotype |
IgG1 Kappa/IgG1 Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
ANO1 |
| Purity |
Protein A or G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry
- Immunohistochemistry-Paraffin
|
| Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. |
| Buffer |
50mM Sodium Borate |
| Preservative |
0.05% Sodium Azide |
| Purity |
Protein A or G purified |
Notes
Sold under license from the Howard Hughes Medical Institute, Janelia Research Campus.
Alternate Names for DOG1/TMEM16A Antibody (DG1/447 + DOG-1.1) [Janelia Fluor® 549]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, IHC, WB
Species: Hu
Applications: IHC, IP, WB
Species: Mu
Applications: Flow, IHC, Neut, WB
Species: Hu(-), Mu
Applications: COMET, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, mIF, WB
Species: Hu
Applications: IHC, IHC-P
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, PLA, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: IHC
Publications for DOG1/TMEM16A Antibody (NBP2-34604JF549) (0)
There are no publications for DOG1/TMEM16A Antibody (NBP2-34604JF549).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DOG1/TMEM16A Antibody (NBP2-34604JF549) (0)
There are no reviews for DOG1/TMEM16A Antibody (NBP2-34604JF549).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for DOG1/TMEM16A Antibody (NBP2-34604JF549) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DOG1/TMEM16A Products
Blogs on DOG1/TMEM16A