DOG1/TMEM16A Antibody (DG1/447 + DOG-1.1) [mFluor Violet 610 SE] Summary
| Immunogen |
Recombinant human canine-1 protein (DG1/447) + A synthetic peptide from human canine-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1). (Uniprot: Q5XX6) |
| Localization |
Cell Surface and Cytoplasmic |
| Marker |
Marker for Gastrointestinal Stromal Tumors |
| Isotype |
IgG1 Kappa/IgG1 Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
ANO1 |
| Purity |
Protein A or G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry
- Immunohistochemistry-Paraffin
|
| Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. |
| Buffer |
50mM Sodium Borate |
| Preservative |
0.05% Sodium Azide |
| Purity |
Protein A or G purified |
Notes
mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.
Alternate Names for DOG1/TMEM16A Antibody (DG1/447 + DOG-1.1) [mFluor Violet 610 SE]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IP, WB
Species: Mu
Applications: Flow, IHC, Neut, WB
Species: Rt
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, PLA, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ELISA, IHC, IP, WB
Species: Hu, Rt
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IHC
Species: Hu
Applications: CyTOF-ready, Flow, WB
Publications for DOG1/TMEM16A Antibody (NBP2-34604MFV610) (0)
There are no publications for DOG1/TMEM16A Antibody (NBP2-34604MFV610).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DOG1/TMEM16A Antibody (NBP2-34604MFV610) (0)
There are no reviews for DOG1/TMEM16A Antibody (NBP2-34604MFV610).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for DOG1/TMEM16A Antibody (NBP2-34604MFV610) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DOG1/TMEM16A Products
Blogs on DOG1/TMEM16A