DOG1/TMEM16A Antibody (DG1/447 + DOG-1.1) [DyLight 680]


There are currently no images for DOG1/TMEM16A Antibody (NBP2-34604FR).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Reactivity HuSpecies Glossary
Applications WB, Flow, ICC/IF, IHC-Fr, IHC-P
DG1/447 + DOG-1.1
DyLight 680

DOG1/TMEM16A Antibody (DG1/447 + DOG-1.1) [DyLight 680] Summary

Recombinant human DOG-1 protein (DG1/447); A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein (DOG-1.1)
Cell Surface and Cytoplasmic
Gastrointestinal Stromal Tumor Marker
Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Flow Cytometry
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin
Theoretical MW
114 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at 4C in the dark.
50mM Sodium Borate
0.05% Sodium Azide
Protein A purified


Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for DOG1/TMEM16A Antibody (DG1/447 + DOG-1.1) [DyLight 680]

  • ANO1
  • anoctamin 1
  • DOG1
  • ORAOV2
  • TAOS2
  • TMEM16A


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Mu
Applications: WB, IHC, Neut
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Mu
Applications: WB
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu
Applications: WB
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready

Publications for DOG1/TMEM16A Antibody (NBP2-34604FR) (0)

There are no publications for DOG1/TMEM16A Antibody (NBP2-34604FR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DOG1/TMEM16A Antibody (NBP2-34604FR) (0)

There are no reviews for DOG1/TMEM16A Antibody (NBP2-34604FR). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DOG1/TMEM16A Antibody (NBP2-34604FR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DOG1/TMEM16A Products

Bioinformatics Tool for DOG1/TMEM16A Antibody (NBP2-34604FR)

Discover related pathways, diseases and genes to DOG1/TMEM16A Antibody (NBP2-34604FR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DOG1/TMEM16A Antibody (NBP2-34604FR)

Discover more about diseases related to DOG1/TMEM16A Antibody (NBP2-34604FR).

Pathways for DOG1/TMEM16A Antibody (NBP2-34604FR)

View related products by pathway.

PTMs for DOG1/TMEM16A Antibody (NBP2-34604FR)

Learn more about PTMs related to DOG1/TMEM16A Antibody (NBP2-34604FR).

Blogs on DOG1/TMEM16A

There are no specific blogs for DOG1/TMEM16A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DOG1/TMEM16A Antibody (DG1/447 DOG-1.1) [DyLight 680] and receive a gift card or discount.


Gene Symbol ANO1