Home » DOC2B » DOC2B Antibodies » DOC2B Antibody

DOC2B Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: DOC2B Antibody [NBP2-87295] - Host: Rabbit. Target Name: RPH3A. Sample Type: Fetal Heart lysates. Antibody Dilution: 1.0ug/ml
Western Blot: DOC2B Antibody [NBP2-87295] - Host: Rabbit. Target Name: RPH3A. Sample Type: Fetal Heart lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

DOC2B Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human DOC2B. Peptide sequence: VWDYDIGKSNDYIGGCQLGISAKGERLKHWYECLKNKDKKIERWHQLQNE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
DOC2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DOC2B Antibody

  • DOC2BL
  • double C2-like domains, beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Doc2-alpha Antibody
AF7904
Western blot shows lysates of NTera‑2 human testicular embryonic carcinoma cell line, P19 mouse embryonal carcinoma cell line, MOLT‑4 human acute lymphoblastic leukemia cell line, SH‑SY5Y human neuroblastoma cell line, and Neuro‑2A mouse neuroblastoma cell line. PVDF membrane was probed with 2 µg/mL of Sheep Anti-Human Doc2 alpha Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7904) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Doc2 alpha at approximately 40 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu, Mu
Applications: WB
DAB2 Antibody
AF8064
Western blot results for A172, HeLa and MCF 10A cell line lysates. A PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human DAB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8064) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for DAB2 at approximately 96 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
DAB2 was detected in immersion fixed A172 cells using Goat Anti-Human DAB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8064) at 1.7 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized in the cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
DAB2 was detected in formalin fixed paraffin-embedded sections of human prostate using Goat Anti-Human DAB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8064) at 3 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: ICC, IHC, WB
UNC13B Antibody
NBP1-33037
Immunocytochemistry/Immunofluorescence: UNC13B Antibody [NBP1-33037] - UNC13B antibody detects UNC13B protein by immunofluorescent analysis. Sample: DIV9 rat E18 primary cortical neuron cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: UNC13B stained by UNC13B antibody diluted at 1:500. Red: beta Tubulin 3/ Tuj1, stained by beta Tubulin 3/ Tuj1 antibody diluted at 1:500. Blue: Fluoroshield with DAPI.
Immunocytochemistry/Immunofluorescence: UNC13B Antibody [NBP1-33037] - Analysis of methanol-fixed HeLa, using UNC13B antibody (Green) at 1:500 dilution. Alpha-tubulin filaments were labeled with an alpha Tubulin antibody (Red) at 1:2000.
Immunohistochemistry-Paraffin: UNC13B Antibody [NBP1-33037] - Paraffin-embedded A549 xenograft, using antibody at 1:500 dilution.
(1 Publication)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
hnRNP C1 + C2
Antibody (SN0652)
NBP2-67656
Flow Cytometry: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Analysis of Hela cells with hnRNP C1+C2 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody
Immunocytochemistry/Immunofluorescence: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Staining hnRNP C1+C2 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Staining hnRNP C1+C2 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(15 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Synaptotagmin 1
Antibody
NBP1-91499
Western Blot: Synaptotagmin 1 Antibody [NBP1-91499] - Mouse Spleen Lysate 1ug/ml Gel Concentration 12%
Immunohistochemistry: Synaptotagmin 1 Antibody [NBP1-91499] - Sample Type: complete mouse retina sections. Red: Primary. Blue: DAPI. Primary Dilution: 1:200. Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L). Secondary Dilution: 1:200. Image Submitted by: David Zenisek. Yale University
Immunocytochemistry/Immunofluorescence: Synaptotagmin 1 Antibody [NBP1-91499] - Sample Type: outer mouse plexiform layer, Red: Primary, Blue: DAPI, Primary Dilution: 1:200, Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L), Secondary Dilution: 1:200, Image Submitted by: David Zenisek, Yale University.
(1 Review)
Species: Bv, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Complement
Component C2b Antibod ...
MAB1936
Complement Component C2b Antibody (269716)
(4 Reviews)
(1 Publication)
Species: Hu
Applications: IP, WB

Syntaxin-BP3/Munc18c A ...
AF5659
Western blot shows lysates of Nalm‑6 human Pre‑B acute lymphocytic leukemia cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human Syntaxin-BP3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5659) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Syntaxin-BP3 at approximately 68 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Species: Hu
Applications: WB
Rabphilin 3A
Antibody
NBP1-87940
Immunohistochemistry-Paraffin: Rabphilin 3A Antibody [NBP1-87940] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: Rabphilin 3A Antibody [NBP1-87940] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Rabphilin 3A Antibody [NBP1-87940] - Staining in human cerebral cortex and pancreas tissues using anti-RPH3A antibody. Corresponding RPH3A RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
Glut4 Antibody -
BSA Free
NBP1-49533
Flow (Intracellular): Glut4 Antibody [NBP1-49533] - An intracellular stain was performed on HepG2 with NBP1-49533 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.
Western Blot: Glut4 Antibody [NBP1-49533] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. The membrane was probed with anti-Glut4 0.5 ug/ml in non-fat milk. Undiffer: undifferentiated; Differ: Differentiated. Image from verified customer review.
Western Blot: Glut4 Antibody [NBP1-49533] - Glycolysis-related genes and proteins were upregulated in differentiated podocytes. Representative blot images of glycolysis-related proteins (n =3). d All proteins were normalized to tubulin and compared to UDPs. *P < 0.05, **P < 0.01, determined by t test. Data are shown as the means +/- SD. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41419-020-2481-5), licensed under a CC-BY licence.
(4 Reviews)
(25 Publications)
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Syntaxin 4 Antibody
NBP1-87374
Immunocytochemistry/Immunofluorescence: Syntaxin 4 Antibody [NBP1-87374] - Staining of human cell line U-251 MG shows localization to plasma membrane. Antibody staining is shown in green.
Western Blot: Syntaxin 4 Antibody [NBP1-87374] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-STX4 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Immunohistochemistry-Paraffin: Syntaxin 4 Antibody [NBP1-87374] - Staining of human lymphoid tissues shows strong membranous positivity in germinal center cells.
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
VAMP-2 Antibody
NB300-595
Flow Cytometry: VAMP-2 Antibody [NB300-595] - Cells were fixed with 70% ethanol for 10 minutes, permeabilized with 0.25% Triton™ X-100 for 20 minutes, and blocked with 5% BSA for 30 minutes at room temperature.
Western Blot: VAMP-2 Antibody [NB300-595] - Analysis was performed on tissues (40 ug lysate) of Mouse Cerebellum (Lane 1), Mouse Brain (Lane 2) and Rat Brain (Lane 3).
Western Blot: VAMP-2 Antibody [NB300-595] - Analysis of rat brain extract.
(4 Publications)
Species: Bv, Mu, Pm, Rt
Applications: Flow, IF, IHC, IHC-P, IP, WB
NSF Antibody
NBP1-87035
Immunocytochemistry/Immunofluorescence: NSF Antibody [NBP1-87035] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: NSF Antibody [NBP1-87035] - Staining of human liver shows low expression as expected.
Western Blot: NSF Antibody [NBP1-87035] - Analysis in human cell line A-549.
(1 Publication)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Glutathione S
Transferase kappa 1 A ...
NBP2-80461
Western Blot: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Western blot analysis of GSTK1 on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1:1000) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5000 dilution was used for 1 hour at room temperature.Positive control:Lane 1: SK-BR-3 cell lysateLane 2: Human skin tissue lysateLane 3: Human placenta tissue lysate
Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Immunohistochemical analysis of paraffin-embedded human liver cancer tissue using anti-GSTK1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes.The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody (1:50) for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.
Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Immunohistochemical analysis of paraffin-embedded human skin tissue using anti-GSTK1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes.The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody (1:50) for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.
Species: Hu
Applications: Flow, IHC, IHC-P, WB
SLCO6A1 Antibody
NBP2-49118
Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining in human testis and endometrium tissues using anti-SLCO6A1 antibody. Corresponding SLCO6A1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining of human testis shows high expression.
Species: Hu
Applications: IHC, IHC-P
DYNLT1 Antibody
NBP2-58497
Western Blot: DYNLT1 Antibody [NBP2-58497] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/Immunofluorescence: DYNLT1 Antibody [NBP2-58497] - Staining of human cell line U-251 MG shows localization to nucleoplasm.
Species: Hu
Applications: ICC/IF, WB
Rabphilin 3A
Antibody
NBP1-87940
Immunohistochemistry-Paraffin: Rabphilin 3A Antibody [NBP1-87940] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: Rabphilin 3A Antibody [NBP1-87940] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Rabphilin 3A Antibody [NBP1-87940] - Staining in human cerebral cortex and pancreas tissues using anti-RPH3A antibody. Corresponding RPH3A RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
Dystroglycan
Antibody [Unconjugate
AF6868
Dystroglycan was detected in immersion fixed paraffin-embedded sections of human skeletal muscle using Sheep Anti-Human Dystroglycan Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6868) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to basement membrane. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of MCF‑7 human breast cancer cell line, SH‑SY5Y human neuroblastoma cell line, human muscle tissue, and human placenta tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Dystroglycan Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6868) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). Specific bands were detected for alpha ‑Dystroglycan at approximately 100-160 kDa (as indicated) and beta ‑Dystroglycan at approximately 42-44 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Western blot shows lysates of HEK293T human embryonic kidney parental cell line and Dystroglycan knockout HEK293T cell line (KO). PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Dystroglycan Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6868) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). Specific bands were detected for alpha ­-Dystroglycan at approximately 110 kDa ­and beta -Dystroglycanat approximately 42 kDa (as indicated) in the parental HEK293T cell line, but is not detectable in knockout HEK293T cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(5 Publications)
Species: Hu
Applications: IHC, KO, WB

Publications for DOC2B Antibody (NBP2-87295) (0)

There are no publications for DOC2B Antibody (NBP2-87295).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DOC2B Antibody (NBP2-87295) (0)

There are no reviews for DOC2B Antibody (NBP2-87295). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DOC2B Antibody (NBP2-87295) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DOC2B Products

Bioinformatics Tool for DOC2B Antibody (NBP2-87295)

Discover related pathways, diseases and genes to DOC2B Antibody (NBP2-87295). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DOC2B Antibody (NBP2-87295)

Discover more about diseases related to DOC2B Antibody (NBP2-87295).
 

Pathways for DOC2B Antibody (NBP2-87295)

View related products by pathway.

PTMs for DOC2B Antibody (NBP2-87295)

Learn more about PTMs related to DOC2B Antibody (NBP2-87295).
 

Research Areas for DOC2B Antibody (NBP2-87295)

Find related products by research area.

Blogs on DOC2B

There are no specific blogs for DOC2B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DOC2B Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol DOC2B