DNAJC3 Recombinant Protein Antigen

Images

 
There are currently no images for DNAJC3 Recombinant Protein Antigen (NBP2-48704PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DNAJC3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DNAJC3.

Source: E. coli

Amino Acid Sequence: YKISTLYYQLGDHELSLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIRDGRYTDATSKYESVMKTEPSIAEYTVR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DNAJC3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48704.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DNAJC3 Recombinant Protein Antigen

  • DnaJ (Hsp40) homolog, subfamily C, member 3
  • HP58
  • Interferon-induced, double-stranded RNA-activated protein kinase inhibitor
  • P58FLJ21288
  • P58IPKProtein kinase inhibitor p58
  • PRKRIdnaJ homolog subfamily C member 3
  • Protein kinase inhibitor of 58 kDa
  • protein-kinase, interferon-inducible double stranded RNA dependent inhibitor

Background

The 58-kDa inhibitor of the interferon-induced double-stranded RNA-activated protein kinase (PKR) is a cellular protein that is activated during influenza virus infection to down-regulate the activity of PKR. The 58-kDa inhibitor of the interferon-induced double-stranded RNA-activated protein kinase (PKR) is a cellular protein that is activated during influenza virus infection to down-regulate the activity of PKR (1). The P58 protein inhibits both the autophosphorylation of PKR and the phosphorylation of the PKR natural substrate, the alpha subunit of eukaryotic initiation factor eIF-2. Sequence analysis revealed that P58 is a member of the tetratricopeptide family of proteins (2). Also, like other J-domain proteins, P58 stimulated the ATPase activity of Hsc70. Taken together, data suggests that P58 is a co-chaperone, possibly directing hsp/Hsc70 to refold, and thus inhibit kinase function (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37242
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB
AF8519
Species: Hu, Mu, Rt
Applications: Simple Western, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, Simple Western, WB
NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-03381
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MAB2014
Species: Hu
Applications: CyTOF-reported, Flow
MAB1058
Species: Hu
Applications: Block, CyTOF-ready, Flow
NB600-1335
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP1-90149
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF1543
Species: Hu
Applications: IHC, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-50419
Species: Hu
Applications: CyTOF-ready, Flow, IP
NB100-496
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP2-92609
Species: Hu, Mu
Applications: ICC/IF, WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-20254
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-26850
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00008878-M01
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-48704PEP
Species: Hu
Applications: AC

Publications for DNAJC3 Recombinant Protein Antigen (NBP2-48704PEP) (0)

There are no publications for DNAJC3 Recombinant Protein Antigen (NBP2-48704PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAJC3 Recombinant Protein Antigen (NBP2-48704PEP) (0)

There are no reviews for DNAJC3 Recombinant Protein Antigen (NBP2-48704PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DNAJC3 Recombinant Protein Antigen (NBP2-48704PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DNAJC3 Products

Research Areas for DNAJC3 Recombinant Protein Antigen (NBP2-48704PEP)

Find related products by research area.

Blogs on DNAJC3

There are no specific blogs for DNAJC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DNAJC3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAJC3