DNAJC1 Antibody

Images

 
Western Blot: DNAJC1 Antibody [NBP1-69608] - This Anti-DNAJC1 antibody was used in Western Blot of MCF7 tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNAJC1 Antibody Summary

Immunogen
Synthetic peptides corresponding to DNAJC1(DnaJ (Hsp40) homolog, subfamily C, member 1) The peptide sequence was selected from the C terminal of DNAJC1. Peptide sequence ELALQQYPRGSSDRWDKIARCVPSKSKEDCIARYKLLVELVQKKKQAKS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNAJC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against DNAJC1 and was validated on Western blot.
Theoretical MW
64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DNAJC1 Antibody

  • DnaJ (Hsp40) homolog, subfamily C, member 1
  • dnaJ homolog subfamily C member 1
  • DnaJ protein homolog MTJ1
  • DNAJL1
  • DnaJ-like protein
  • ERdj1
  • HTJ1
  • MGC131954
  • MTJ1

Background

DNAJC1 contains 1 J domain and 2 SANT domains. The exact function of DNAJC1 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
H00010049-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-02996
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1543
Species: Hu
Applications: WB, IHC
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03433
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-30405
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52559
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
H00000072-D01P
Species: Hu
Applications: WB
MAB7185
Species: Hu
Applications: WB, Simple Western
NBP1-89278
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009457-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-84899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90010
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32731
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-69608
Species: Hu
Applications: WB

Publications for DNAJC1 Antibody (NBP1-69608) (0)

There are no publications for DNAJC1 Antibody (NBP1-69608).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAJC1 Antibody (NBP1-69608) (0)

There are no reviews for DNAJC1 Antibody (NBP1-69608). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNAJC1 Antibody (NBP1-69608) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNAJC1 Products

Bioinformatics Tool for DNAJC1 Antibody (NBP1-69608)

Discover related pathways, diseases and genes to DNAJC1 Antibody (NBP1-69608). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNAJC1 Antibody (NBP1-69608)

Discover more about diseases related to DNAJC1 Antibody (NBP1-69608).
 

Pathways for DNAJC1 Antibody (NBP1-69608)

View related products by pathway.

PTMs for DNAJC1 Antibody (NBP1-69608)

Learn more about PTMs related to DNAJC1 Antibody (NBP1-69608).

Blogs on DNAJC1

There are no specific blogs for DNAJC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNAJC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAJC1
Uniprot