DNA polymerase sigma Antibody


Western Blot: DNA polymerase sigma Antibody [NBP2-13729] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: DNA polymerase sigma Antibody [NBP2-13729] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: DNA polymerase sigma Antibody [NBP2-13729] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Western Blot: DNA polymerase sigma Antibody [NBP2-13729] - Analysis in human cell line HeLa.
Immunohistochemistry-Paraffin: DNA polymerase sigma Antibody [NBP2-13729] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

DNA polymerase sigma Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: ARSYPNRDAESTLGRIIKVTQEVIDYRRWIKEKWGSKAHPSPGMDSRIKI KERIATCNGEQTQNREPESPYGQRLTLSLSS
Specificity of human, mouse DNA polymerase sigma antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DNA polymerase sigma Protein (NBP2-13729PEP)

Reactivity Notes

Rat (84%).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DNA polymerase sigma Antibody

  • DNA polymerase kappa
  • DNA polymerase sigma
  • EC
  • LAK-1TUTase 5
  • PAP associated domain containing 7
  • polymerase (DNA directed) sigma
  • polymerase (DNA-directed) sigma
  • Terminal uridylyltransferase 5
  • Topoisomerase-related function protein 4-1
  • TRF4-1LAK1
  • TRF4PAP-associated domain-containing protein 7


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Flow, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DNA polymerase sigma Antibody (NBP2-13729) (0)

There are no publications for DNA polymerase sigma Antibody (NBP2-13729).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNA polymerase sigma Antibody (NBP2-13729) (0)

There are no reviews for DNA polymerase sigma Antibody (NBP2-13729). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DNA polymerase sigma Antibody (NBP2-13729) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DNA polymerase sigma Products

Bioinformatics Tool for DNA polymerase sigma Antibody (NBP2-13729)

Discover related pathways, diseases and genes to DNA polymerase sigma Antibody (NBP2-13729). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNA polymerase sigma Antibody (NBP2-13729)

Discover more about diseases related to DNA polymerase sigma Antibody (NBP2-13729).

Pathways for DNA polymerase sigma Antibody (NBP2-13729)

View related products by pathway.

PTMs for DNA polymerase sigma Antibody (NBP2-13729)

Learn more about PTMs related to DNA polymerase sigma Antibody (NBP2-13729).

Blogs on DNA polymerase sigma

There are no specific blogs for DNA polymerase sigma, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DNA polymerase sigma Antibody and receive a gift card or discount.


Gene Symbol PAPD7