DNA polymerase sigma Antibody

Product Discontinued

DNA polymerase sigma Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ARSYPNRDAESTLGRIIKVTQEVIDYRRWIKEKWGSKAHPSPGMDSRIKI KERIATCNGEQTQNREPESPYGQRLTLSLSS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TENT4A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:10-1:20
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Rat (84%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DNA polymerase sigma Antibody

• DNA polymerase kappa
• DNA polymerase sigma
• EC 2.7.7.7
• LAK-1TUTase 5
• PAP associated domain containing 7
• POLKTRF41
• POLSTUTASE5
• polymerase (DNA directed) sigma
• polymerase (DNA-directed) sigma
• Terminal uridylyltransferase 5
• Topoisomerase-related function protein 4-1
• TRF4-1LAK1
• TRF4PAP-associated domain-containing protein 7

Background

DNA polymerase sigma is encoded by this gene is a DNA polymerase that is likely involved in DNA repair. In addition, the encoded protein may be required for sister chromatid adhesion.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TENT4A