Recombinant Human DNA Ligase IV Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human DNA Ligase IV Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 802-911 of Human DNA Ligase IV

Source: Wheat Germ

Amino Acid Sequence: RYSWDCSPLSMFRRHTVYLDSYAVINDLSTKNEGTRLAIKALELRFHGAKVVSCLAEGVSHVIIGEDHSRVADFKAFRRTFKRKFKILKESWVTDSIDKCELQEENQYLI

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
LIG4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
37.73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DNA Ligase IV Protein

  • DNA joinase
  • DNA ligase 4
  • DNA ligase IV
  • DNA repair enzyme
  • EC 6.5.1.1
  • ligase IV, DNA, ATP-dependent
  • Polydeoxyribonucleotide synthase [ATP] 4
  • polynucleotide ligase
  • sealase

Background

LIG4 - ligase IV, DNA, ATP-dependent

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NBP1-89463
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
NBP2-22128
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-106
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-56408
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1915
Species: Hu, Mu, Rt, Ha, Pm, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB600-1031
Species: Hu, Mu, Rt, Rb
Applications: WB, ICC/IF, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
NB100-183
Species: Hu
Applications: WB
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
NBP2-03275
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KO
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
H00003981-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for DNA Ligase IV Partial Recombinant Protein (H00003981-Q01) (0)

There are no publications for DNA Ligase IV Partial Recombinant Protein (H00003981-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNA Ligase IV Partial Recombinant Protein (H00003981-Q01) (0)

There are no reviews for DNA Ligase IV Partial Recombinant Protein (H00003981-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNA Ligase IV Partial Recombinant Protein (H00003981-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DNA Ligase IV Products

Bioinformatics Tool for DNA Ligase IV Partial Recombinant Protein (H00003981-Q01)

Discover related pathways, diseases and genes to DNA Ligase IV Partial Recombinant Protein (H00003981-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNA Ligase IV Partial Recombinant Protein (H00003981-Q01)

Discover more about diseases related to DNA Ligase IV Partial Recombinant Protein (H00003981-Q01).
 

Pathways for DNA Ligase IV Partial Recombinant Protein (H00003981-Q01)

View related products by pathway.

PTMs for DNA Ligase IV Partial Recombinant Protein (H00003981-Q01)

Learn more about PTMs related to DNA Ligase IV Partial Recombinant Protein (H00003981-Q01).
 

Research Areas for DNA Ligase IV Partial Recombinant Protein (H00003981-Q01)

Find related products by research area.

Blogs on DNA Ligase IV

There are no specific blogs for DNA Ligase IV, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Nbs1 Antibody
NB100-143
Mre11 Antibody
NB100-142

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DNA Ligase IV Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LIG4