DMRTA1 Antibody - BSA Free

Western Blot: DMRTA1 Antibody [NBP2-84794] - WB Suggested Anti-DMRTA1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: Hela cell lysate

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

DMRTA1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DMRTA1 Antibody - BSA Free (NBP2-84794) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DMRTA1. Peptide sequence: AENPQSTGGPAAGAALGLGALRQASGSATPAFEVFQQDYPEEKQEQKESK The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DMRTA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for DMRTA1 Antibody - BSA Free

• DMO
• DMRT-like family A1
• doublesex- and mab-3-related transcription factor A1
• MGC163307
• MGC163309

Background

DMRTA1, also known as Doublesex and mab-3-related transcription factor A1, is a 53.1 kDa, 504 amino acid protein that is expressed in the prostate, pancreas, liver, and kidney as a member of the DMRT family. Current research is exploring the involvement of the protein with prostatitis and metabolic acidosis. The protein interacts with STAT5B and ORC5 proteins in transcription pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DMRTA1