DMP-1 Recombinant Protein Antigen

Images

 
There are currently no images for DMP-1 Protein (NBP1-89484PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DMP-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DMP1.

Source: E. coli

Amino Acid Sequence: QYIYRLAGGFSRSTGKGGDDKDDDEDDSGDDTFGDDDSGPGPKDRQEGGNSRLGSDEDSDDTIQASEESAPQGQDSAQDTTSE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DMP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89484.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DMP-1 Recombinant Protein Antigen

  • ARHP
  • ARHR
  • dentin matrix acidic phosphoprotein 1
  • dentin matrix acidic phosphoprotein
  • Dentin matrix protein 1
  • DMP1
  • DMP-1

Background

Dentin matrix acidic phosphoprotein is an extracellular matrix protein and a member of the small integrin binding ligand N-linked glycoprotein family. This protein, which is critical for proper mineralization of bone and dentin, is present in diverse cells of bone and tooth tissues. The protein contains a large number of acidic domains, multiple phosphorylation sites, a functional arg-gly-asp cell attachment sequence, and a DNA binding domain. In undifferentiated osteoblasts it is primarily a nuclear protein that regulates the expression of osteoblast-specific genes. During osteoblast maturation the protein becomes phosphorylated and is exported to the extracellular matrix, where it orchestrates mineralized matrix formation. Mutations in the gene are known to cause autosomal recessive hypophosphatemia, a disease that manifests as rickets and osteomalacia. The gene structure is conserved in mammals. Two transcript variants encoding different isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92546
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
4014-SP
Species: Hu
Applications: BA
MAB26291
Species: Mu
Applications: IHC
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
8090-ZN
Species: Hu
Applications: EnzAct
AF6150
Species: Mu
Applications: WB
MAB9080
Species: Hu
Applications: WB
DPI00
Species: Hu
Applications: ELISA
DCC270
Species: Hu
Applications: ELISA
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, RI, WB
NBP2-92749
Species: Hu, Mu
Applications: ELISA, WB
NBP3-15742
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-25358
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
MAB7665
Species: Hu
Applications: IHC, WB

Publications for DMP-1 Protein (NBP1-89484PEP) (0)

There are no publications for DMP-1 Protein (NBP1-89484PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DMP-1 Protein (NBP1-89484PEP) (0)

There are no reviews for DMP-1 Protein (NBP1-89484PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DMP-1 Protein (NBP1-89484PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DMP-1 Products

Blogs on DMP-1

There are no specific blogs for DMP-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DMP-1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DMP1