Recombinant Human DMP-1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related DMP-1 Peptides and Proteins

Order Details


    • Catalog Number
      H00001758-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human DMP-1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human DMP1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ESIRSERGNSRMNSAGMKSKESGENSEQANTQDSGGSQLLEHPSRKIFRKSRISEEDDRSELDDNNTMEEVKSDSTENSNSRDTGLSQPRRDSKGDSQEDSKENLSQEES

Protein/Peptide Type
Partial Recombinant Protein
Gene
DMP1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DMP-1 Protein

  • ARHP
  • ARHR
  • dentin matrix acidic phosphoprotein 1
  • dentin matrix acidic phosphoprotein
  • Dentin matrix protein 1
  • DMP1
  • DMP-1

Background

Dentin matrix acidic phosphoprotein is an extracellular matrix protein and a member of the small integrin binding ligand N-linked glycoprotein family. This protein, which is critical for proper mineralization of bone and dentin, is present in diverse cells of bone and tooth tissues. The protein contains a large number of acidic domains, multiple phosphorylation sites, a functional arg-gly-asp cell attachment sequence, and a DNA binding domain. In undifferentiated osteoblasts it is primarily a nuclear protein that regulates the expression of osteoblast-specific genes. During osteoblast maturation the protein becomes phosphorylated and is exported to the extracellular matrix, where it orchestrates mineralized matrix formation. Mutations in the gene are known to cause autosomal recessive hypophosphatemia, a disease that manifests as rickets and osteomalacia. The gene structure is conserved in mammals. Two transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

46780002
Species: Hu
Applications: ELISA
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
2629-FG/CF
Species: Mu
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
8090-ZN
Species: Hu
AF6150
Species: Mu
Applications: WB
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-42378
Species: Hu
Applications: WB, IHC
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for DMP-1 Partial Recombinant Protein (H00001758-Q01) (0)

There are no publications for DMP-1 Partial Recombinant Protein (H00001758-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DMP-1 Partial Recombinant Protein (H00001758-Q01) (0)

There are no reviews for DMP-1 Partial Recombinant Protein (H00001758-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DMP-1 Partial Recombinant Protein (H00001758-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DMP-1 Products

Bioinformatics Tool for DMP-1 Partial Recombinant Protein (H00001758-Q01)

Discover related pathways, diseases and genes to DMP-1 Partial Recombinant Protein (H00001758-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DMP-1 Partial Recombinant Protein (H00001758-Q01)

Discover more about diseases related to DMP-1 Partial Recombinant Protein (H00001758-Q01).
 

Pathways for DMP-1 Partial Recombinant Protein (H00001758-Q01)

View related products by pathway.

PTMs for DMP-1 Partial Recombinant Protein (H00001758-Q01)

Learn more about PTMs related to DMP-1 Partial Recombinant Protein (H00001758-Q01).

Blogs on DMP-1

There are no specific blogs for DMP-1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DMP-1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DMP1
Entrez