DKFZp566F084 Antibody

Images

 
Immunohistochemistry-Paraffin: DKFZp566F084 Antibody [NBP1-87988] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DKFZp566F084 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KWRVKSALGAMGQWQLEVGDPAPLGAGNLGPELIKESNANPIFMRKDTKMSFQWRIRNLPYPKDVYSVSVDQKERCIIVRTTNKK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DPCD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DKFZp566F084 Protein (NBP1-87988PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DKFZp566F084 Antibody

  • deleted in a mouse model of primary ciliary dyskinesia
  • deleted in primary ciliary dyskinesia homolog (mouse)
  • DKFZP566F084
  • protein DPCD
  • RP11-529I10.4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-81665
Species: Hu, Mu
Applications: WB (-), IHC-P, IP
NBP1-87219
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6270
Species: Hu
Applications: ICC
NBP1-83482
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14013
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80528
Species: Hu
Applications: WB
NBP1-20229
Species: Hu, Mu
Applications: WB, ICC/IF, IHC
NBP2-49207
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NLS5103
Species: Hu, Bv, Ca
Applications: IHC-P, ICC
NBP1-88242
Species: Hu
Applications: IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6739
Species: Hu, Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
MAB7675
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1001
Species: Hu, Mu
Applications: Flow, IHC, CyTOF-ready

Publications for DKFZp566F084 Antibody (NBP1-87988) (0)

There are no publications for DKFZp566F084 Antibody (NBP1-87988).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DKFZp566F084 Antibody (NBP1-87988) (0)

There are no reviews for DKFZp566F084 Antibody (NBP1-87988). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DKFZp566F084 Antibody (NBP1-87988) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DKFZp566F084 Products

Bioinformatics Tool for DKFZp566F084 Antibody (NBP1-87988)

Discover related pathways, diseases and genes to DKFZp566F084 Antibody (NBP1-87988). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DKFZp566F084 Antibody (NBP1-87988)

Discover more about diseases related to DKFZp566F084 Antibody (NBP1-87988).
 

Pathways for DKFZp566F084 Antibody (NBP1-87988)

View related products by pathway.

PTMs for DKFZp566F084 Antibody (NBP1-87988)

Learn more about PTMs related to DKFZp566F084 Antibody (NBP1-87988).

Blogs on DKFZp566F084

There are no specific blogs for DKFZp566F084, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DKFZp566F084 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DPCD