We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

DKC1 Recombinant Protein Antigen

Images

 
There are currently no images for DKC1 Protein (NBP1-85156PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DKC1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DKC1.

Source: E. coli

Amino Acid Sequence: EAGTYIRTLCVHLGLLLGVGGQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVIT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DKC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85156.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DKC1 Recombinant Protein Antigen

  • CBF5 homolog
  • CBF5
  • cbf5p homolog
  • DKC
  • dyskeratosis congenita 1, dyskerin
  • Dyskerin
  • EC 5.4.99
  • EC 5.4.99.-
  • FLJ97620
  • H/ACA ribonucleoprotein complex subunit 4
  • NAP57
  • NOLA4dyskerin
  • Nopp140-associated protein of 57 kDa
  • Nucleolar protein family A member 4
  • Nucleolar protein NAP57
  • snoRNP protein DKC1
  • XAP101

Background

DKC1 is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also include the NOLA1, 2 and 3 proteins. The protein encoded by this gene and the three NOLA proteins localize to the dense fibrillar components of nucleoli and to coiled (Cajal) bodies in the nucleus. Both 18S rRNA production and rRNA pseudouridylation are impaired if any one of the four proteins is depleted. These four H/ACA snoRNP proteins are also components of the telomerase complex. The protein encoded by this gene is related to the Saccharomyces cerevisiae Cbf5p and Drosophila melanogaster Nop60B proteins. The gene lies in a tail-to-tail orientation with the palmitoylated erythrocyte membrane protein gene and is transcribed in a telomere to centromere direction. Both nucleotide substitutions and single trinucleotide repeat polymorphisms have been found in this gene. Mutations in this gene cause X-linked dyskeratosis congenita, a disease resulting in reticulate skin pigmentation, mucosal leukoplakia, nail dystrophy, and progressive bone marrow failure in most cases. Mutations in this gene also cause Hoyeraal-Hreidarsson syndrome, which is a more severe form of dyskeratosis congenita. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-317
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-32441
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-13656
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-31742
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western
NBP3-12461
Species: Hu, Rt
Applications: ELISA, IP, WB
NBP3-46699
Species: Hu, Mu
Applications: ELISA, WB
NBP3-45024
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP3-38210
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-92684
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-89306
Species: Hu, Mu, Rt
Applications:  IHC-P, KD, WB
NBP2-81793
Species: Hu
Applications: ELISA, ICC/IF, WB
NB100-68252
Species: Hu
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, KO, WB
H00004354-M01
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
NBP1-46846
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP1-77306
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-83837
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-85156PEP
Species: Hu
Applications: AC

Publications for DKC1 Protein (NBP1-85156PEP) (0)

There are no publications for DKC1 Protein (NBP1-85156PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DKC1 Protein (NBP1-85156PEP) (0)

There are no reviews for DKC1 Protein (NBP1-85156PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DKC1 Protein (NBP1-85156PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DKC1 Products

Blogs on DKC1

There are no specific blogs for DKC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DKC1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DKC1