New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

Recombinant Human DKC1 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human DKC1 Protein [H00001736-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human DKC1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 321-420 of Human DKC1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: LRYEDGIEVNQEIVVITTKGEAICMAIALMTTAVISTCDHGIVAKIKRVIMERDTYPRKWGLGPKASQKKLMIKQGLLDKHGKPTDSTPATWKQEYVDYS

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
DKC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DKC1 GST (N-Term) Protein

  • CBF5 homolog
  • CBF5
  • cbf5p homolog
  • DKC
  • dyskeratosis congenita 1, dyskerin
  • Dyskerin
  • EC 5.4.99
  • EC 5.4.99.-
  • FLJ97620
  • H/ACA ribonucleoprotein complex subunit 4
  • NAP57
  • NOLA4dyskerin
  • Nopp140-associated protein of 57 kDa
  • Nucleolar protein family A member 4
  • Nucleolar protein NAP57
  • snoRNP protein DKC1
  • XAP101

Background

DKC1 - dyskeratosis congenita 1, dyskerin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-317
Species: Hu, Mu, Rt
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-32441
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13656
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-31742
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-12461
Species: Hu, Rt
Applications: ELISA, IP, WB
NBP2-93867
Species: Hu, Mu, Rt
Applications: WB
NBP2-55709
Species: Hu
Applications: ICC/IF, WB
NBP1-58200
Species: Hu, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP1-89306
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
NBP1-92388
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-68252
Species: Hu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KO, WB
H00004354-M01
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
NBP1-81680
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77306
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB
NBP1-83837
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
H00001736-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for DKC1 Partial Recombinant Protein (H00001736-Q01) (0)

There are no publications for DKC1 Partial Recombinant Protein (H00001736-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DKC1 Partial Recombinant Protein (H00001736-Q01) (0)

There are no reviews for DKC1 Partial Recombinant Protein (H00001736-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DKC1 Partial Recombinant Protein (H00001736-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DKC1 Products

Bioinformatics Tool for DKC1 Partial Recombinant Protein (H00001736-Q01)

Discover related pathways, diseases and genes to DKC1 Partial Recombinant Protein (H00001736-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DKC1 Partial Recombinant Protein (H00001736-Q01)

Discover more about diseases related to DKC1 Partial Recombinant Protein (H00001736-Q01).
 

Pathways for DKC1 Partial Recombinant Protein (H00001736-Q01)

View related products by pathway.

PTMs for DKC1 Partial Recombinant Protein (H00001736-Q01)

Learn more about PTMs related to DKC1 Partial Recombinant Protein (H00001736-Q01).

Blogs on DKC1

There are no specific blogs for DKC1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DKC1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DKC1