DISP1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DISP1. Source: E. coli
Amino Acid Sequence: GKTNVHSLQRSIEEHLPKMAEPSSFVCRSTGSLLKTCCDPENKQRELCKNRDVSNLESSGGTENKAGGKVELSLSQTDASVNSE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
DISP1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13925. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for DISP1 Recombinant Protein Antigen
Background
The pattern of cellular proliferation and differentiation that leads to normal development of embryonic structuresoften depends upon the localized production of secreted protein signals. Cells surrounding the source of a particularsignal respond in a graded manner according to the effective concentration of the signal, and this response producesthe pattern of cell types constituting the mature structure. A novel segment-polarity gene known as dispatched hasbeen identified in Drosophila and its protein product is required for normal Hedgehog (Hh) signaling. This gene is oneof two human homologs of Drosophila dispatched and, based on sequence identity to its mouse counterpart, the encodedprotein may play an essential role in Hh patterning activities in the early embryo. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: BA
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu
Applications: ChIP, ICC, IHC, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bt, Bv, Ca, Eq, Ha, Hu, Pm, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, ICC, WB
Species: Bv, Ca, Ch, Eq, Hu, Mu, Pm
Applications: WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, WB
Species: Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, IB, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Publications for DISP1 Protein (NBP2-13925PEP) (0)
There are no publications for DISP1 Protein (NBP2-13925PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DISP1 Protein (NBP2-13925PEP) (0)
There are no reviews for DISP1 Protein (NBP2-13925PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for DISP1 Protein (NBP2-13925PEP) (0)
Additional DISP1 Products
Research Areas for DISP1 Protein (NBP2-13925PEP)
Find related products by research area.
|
Blogs on DISP1