Dishevelled-2 Recombinant Protein Antigen

Images

 
There are currently no images for Dishevelled-2 Protein (NBP1-87550PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Dishevelled-2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DVL2.

Source: E.coli

Amino Acid Sequence: FNGRVVSWLVSSDNPQPEMAPPVHEPRAELAPPAPPLPPLPPERTSGIGDSRPPSFHPNVSSSHENLEPETETESVV

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DVL2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-87550.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Dishevelled-2 Recombinant Protein Antigen

  • dishevelled 2 (homologous to Drosophila dsh)
  • dishevelled, dsh homolog 2 (Drosophila)
  • Dishevelled2
  • Dishevelled-2
  • DSH homolog 2
  • DVL2
  • segment polarity protein dishevelled homolog DVL-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24648
Species: Hu, Mu, Rt, Pm
Applications: WB
NBP2-24674
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB, IHC-P
645-WN
Species: Hu, Mu
AF4815
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF1927
Species: Hu
Applications: WB, IP, ICC
AF7164
Species: Hu
Applications: WB
AF6278
Species: Hu, Mu
Applications: WB
AF3287
Species: Hu, Mu, Rt
Applications: WB
NBP2-24768
Species: Hu, Mu, Rt, Ch, Pm, Xp, Ze
Applications: WB, IHC-P
AF1505
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24493
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB
NB100-1699
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IP
NBP2-66402
Species: Hu
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC

Publications for Dishevelled-2 Protein (NBP1-87550PEP) (0)

There are no publications for Dishevelled-2 Protein (NBP1-87550PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dishevelled-2 Protein (NBP1-87550PEP) (0)

There are no reviews for Dishevelled-2 Protein (NBP1-87550PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Dishevelled-2 Protein (NBP1-87550PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Dishevelled-2 Protein (NBP1-87550PEP)

Discover related pathways, diseases and genes to Dishevelled-2 Protein (NBP1-87550PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dishevelled-2 Protein (NBP1-87550PEP)

Discover more about diseases related to Dishevelled-2 Protein (NBP1-87550PEP).
 

Pathways for Dishevelled-2 Protein (NBP1-87550PEP)

View related products by pathway.

PTMs for Dishevelled-2 Protein (NBP1-87550PEP)

Learn more about PTMs related to Dishevelled-2 Protein (NBP1-87550PEP).
 

Research Areas for Dishevelled-2 Protein (NBP1-87550PEP)

Find related products by research area.

Blogs on Dishevelled-2

There are no specific blogs for Dishevelled-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Wnt-5a
645-WN-010

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Dishevelled-2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DVL2