DIAPH1 Antibody

Images

 
Western Blot: DIAPH1 Antibody [H00001729-B02P] - Analysis of DIAPH1 expression in transfected 293T cell line by DIAPH1 polyclonal antibody. Lane 1: DIAPH1 transfected lysate(44.44 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: DIAPH1 Antibody [H00001729-B02P] - Analysis of purified antibody to DIAPH1 on HeLa cell. (antibody concentration 10 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DIAPH1 Antibody Summary

Immunogen
DIAPH1 (AAH07411, 1 a.a. - 404 a.a.) full-length human protein. MPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKDEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGEYFLFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQANRKAGCAVTSLLASELTKDDAMAAVPAKVSKNSETFPTILEEAKELVGRAS
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
DIAPH1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DIAPH1 Antibody

  • DIA1
  • diaphanous homolog 1 (Drosophila)
  • hDIA1
  • homolog) 1
  • LFHL1FLJ25265

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-85217
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00081624-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2635
Species: Hu
Applications: WB
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-88460
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
AF1444
Species: Mu
Applications: WB, IHC
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
H00001729-B02P
Species: Hu
Applications: WB, ICC/IF

Publications for DIAPH1 Antibody (H00001729-B02P) (0)

There are no publications for DIAPH1 Antibody (H00001729-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DIAPH1 Antibody (H00001729-B02P) (0)

There are no reviews for DIAPH1 Antibody (H00001729-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DIAPH1 Antibody (H00001729-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DIAPH1 Products

Bioinformatics Tool for DIAPH1 Antibody (H00001729-B02P)

Discover related pathways, diseases and genes to DIAPH1 Antibody (H00001729-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DIAPH1 Antibody (H00001729-B02P)

Discover more about diseases related to DIAPH1 Antibody (H00001729-B02P).
 

Pathways for DIAPH1 Antibody (H00001729-B02P)

View related products by pathway.

PTMs for DIAPH1 Antibody (H00001729-B02P)

Learn more about PTMs related to DIAPH1 Antibody (H00001729-B02P).
 

Research Areas for DIAPH1 Antibody (H00001729-B02P)

Find related products by research area.

Blogs on DIAPH1

There are no specific blogs for DIAPH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DIAPH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DIAPH1
Uniprot