DIAPH1 Antibody (5A8)

Images

 
Sandwich ELISA: DIAPH1 Antibody (5A8) [H00001729-M01] - Detection limit for recombinant GST tagged DIAPH1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
5A8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DIAPH1 Antibody (5A8) Summary

Immunogen
DIAPH1 (NP_005210 921 a.a. - 1024 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELAHVEKAS
Specificity
DIAPH1 - diaphanous homolog 1 (Drosophila)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DIAPH1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DIAPH1 Antibody (5A8)

  • DIA1
  • diaphanous homolog 1 (Drosophila)
  • hDIA1
  • homolog) 1
  • LFHL1FLJ25265

Background

This gene is a homolog of the Drosophila diaphanous gene, and has been linked to autosomal dominant, fully penetrant, nonsyndromic sensorineural progressive low-frequency hearing loss. Actin polymerization involves proteins known to interact with diaphanous protein in Drosophila and mouse. It has therefore been speculated that this gene may have a role in the regulation of actin polymerization in hair cells of the inner ear. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-85217
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00081624-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87814
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2635
Species: Hu
Applications: WB
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-88460
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
AF1444
Species: Mu
Applications: WB, IHC
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
H00001729-M01
Species: Hu
Applications: WB, ELISA

Publications for DIAPH1 Antibody (H00001729-M01) (0)

There are no publications for DIAPH1 Antibody (H00001729-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DIAPH1 Antibody (H00001729-M01) (0)

There are no reviews for DIAPH1 Antibody (H00001729-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DIAPH1 Antibody (H00001729-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DIAPH1 Products

Bioinformatics Tool for DIAPH1 Antibody (H00001729-M01)

Discover related pathways, diseases and genes to DIAPH1 Antibody (H00001729-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DIAPH1 Antibody (H00001729-M01)

Discover more about diseases related to DIAPH1 Antibody (H00001729-M01).
 

Pathways for DIAPH1 Antibody (H00001729-M01)

View related products by pathway.

PTMs for DIAPH1 Antibody (H00001729-M01)

Learn more about PTMs related to DIAPH1 Antibody (H00001729-M01).
 

Research Areas for DIAPH1 Antibody (H00001729-M01)

Find related products by research area.

Blogs on DIAPH1

There are no specific blogs for DIAPH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DIAPH1 Antibody (5A8) and receive a gift card or discount.

Bioinformatics

Gene Symbol DIAPH1
Entrez
OMIM
Uniprot