DIAPH1 Antibody (5A8) Summary
Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
Immunogen |
DIAPH1 (NP_005210, 921 a.a. ~ 1024 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELAHVEKAS |
Specificity |
DIAPH1 - diaphanous homolog 1 (Drosophila) |
Isotype |
IgG2b Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
DIAPH1 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot 1:500
|
Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for DIAPH1 Antibody (5A8)
Background
This gene is a homolog of the Drosophila diaphanous gene, and has been linked to autosomal dominant, fully penetrant, nonsyndromic sensorineural progressive low-frequency hearing loss. Actin polymerization involves proteins known to interact with diaphanous protein in Drosophila and mouse. It has therefore been speculated that this gene may have a role in the regulation of actin polymerization in hair cells of the inner ear. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC-P, IP, PA, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, Simple Western, WB
Publications for DIAPH1 Antibody (H00001729-M01) (0)
There are no publications for DIAPH1 Antibody (H00001729-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DIAPH1 Antibody (H00001729-M01) (0)
There are no reviews for DIAPH1 Antibody (H00001729-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DIAPH1 Antibody (H00001729-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DIAPH1 Products
Bioinformatics Tool for DIAPH1 Antibody (H00001729-M01)
Discover related pathways, diseases and genes to DIAPH1 Antibody (H00001729-M01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for DIAPH1 Antibody (H00001729-M01)
Discover more about diseases related to DIAPH1 Antibody (H00001729-M01).
| | Pathways for DIAPH1 Antibody (H00001729-M01)
View related products by pathway.
|
PTMs for DIAPH1 Antibody (H00001729-M01)
Learn more about PTMs related to DIAPH1 Antibody (H00001729-M01).
| | Research Areas for DIAPH1 Antibody (H00001729-M01)
Find related products by research area.
|
Blogs on DIAPH1