DGK-delta Recombinant Protein Antigen

Images

 
There are currently no images for DGK-delta Recombinant Protein Antigen (NBP2-58630PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DGK-delta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to DGK-delta.

Source: E. coli

Amino Acid Sequence: TQMDQFGQAAGVLIHSIREIAQSHRDMEQELAHAVNASSKSMDRVYGKPRTTEGLNCSFVLEMVNNFRALRSETELLLSGKMALQLDPPQKEQLGSALAEMDRQLRRLADTPWLCQSAEPGDEESVMLDLA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DGKD
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58630.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DGK-delta Recombinant Protein Antigen

  • 130 kDa diacylglycerol kinase
  • DAG kinase delta
  • DGKD
  • dgkd-2
  • DGKdelta
  • DGK-delta
  • diacylglycerol kinase delta
  • diacylglycerol kinase, delta (130kD)
  • diacylglycerol kinase, delta 130kDa
  • Diglyceride kinase delta
  • FLJ26930
  • KIAA0145EC 2.7.1.107

Background

Diacylglycerol kinases (DGKs) phosphorylate diacylglycerol (DAG) to produce phosphatidic acid. DAG and phosphatidic acid are lipids that act as second messengers in signaling cascades. DGK-alpha influences cell activation and secretion of lethal exosomes, which in turn control cell death. DGK-beta is abundant in restricted brain regions such as the caudate putamen and olfactory tubercle. DGK-gamma encodes full-length and truncated transcripts that are present in a range of human tissues, with greatest expression observed in retina. DGK-delta is most abundant in skeletal muscle. DGK-episilon shows specificity for arachidonylcontaining diacylglycerol and is expressed predominantly in testis. DGK-theta is most abundant in the cerebellum and hippocampus. DGK-iota is present in brain and retina as a predominant transcript of more than 12 kb, including a long 3-prime untranslated region, with additional low abundance transcripts of 9.5 and 7.5 kb. DGK-eta is closely related to DGK-delta. DGK-zeta is most abundant in brain and muscle. DGKs have structural motifs that play regulatory roles, and these motifs form the basis for dividing the DGKs into five subtypes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB5125
Species: Hu, Mu, Rt
Applications: IHC, WB
MAB6727
Species: Hu
Applications: WB
NBP2-49251
Species: Hu
Applications: IHC,  IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
236-EG
Species: Hu
Applications: BA
NB100-1343
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
AF6868
Species: Hu
Applications: IHC, KO, WB
AF3434
Species: Hu, Mu, Rt
Applications: ICC, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP2-46518
Species: Hu
Applications: IHC,  IHC-P, WB
H00002038-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-01763
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP1-86037
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP3-46899
Species: Hu
Applications: ELISA, ICC/IF, WB
2914-HT
Species: Hu
Applications: BA
NBP2-58630PEP
Species: Hu
Applications: AC

Publications for DGK-delta Recombinant Protein Antigen (NBP2-58630PEP) (0)

There are no publications for DGK-delta Recombinant Protein Antigen (NBP2-58630PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DGK-delta Recombinant Protein Antigen (NBP2-58630PEP) (0)

There are no reviews for DGK-delta Recombinant Protein Antigen (NBP2-58630PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DGK-delta Recombinant Protein Antigen (NBP2-58630PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DGK-delta Products

Research Areas for DGK-delta Recombinant Protein Antigen (NBP2-58630PEP)

Find related products by research area.

Blogs on DGK-delta

There are no specific blogs for DGK-delta, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DGK-delta Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DGKD