DGK-delta Recombinant Protein Antigen

Images

 
There are currently no images for DGK-delta Protein (NBP2-13917PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DGK-delta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DGKD.

Source: E.coli

Amino Acid Sequence: TELLLSGKMALQLDPPQKEQLGSALAEMDRQLRRLADTPWLCQSAEPGDEESVMLDLAKRSRSGKFRLVTKFKKEKNNKNKEAHS

Protein/Peptide Type
Recombinant Protein Antigen
Gene
DGKD
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-13917.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DGK-delta Recombinant Protein Antigen

  • 130 kDa diacylglycerol kinase
  • DAG kinase delta
  • DGKD
  • dgkd-2
  • DGKdelta
  • DGK-delta
  • diacylglycerol kinase delta
  • diacylglycerol kinase, delta (130kD)
  • diacylglycerol kinase, delta 130kDa
  • Diglyceride kinase delta
  • FLJ26930
  • KIAA0145EC 2.7.1.107

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB5125
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB6727
Species: Hu
Applications: WB
NBP1-84256
Species: Hu
Applications: WB, IHC, IHC-P
AF1095
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00612
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
AF6008
Species: Hu, Mu, Rt
Applications: WB
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00005555-P01
Species: Hu
H00005554-R02
Species: Hu
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-13917PEP
Species: Hu
Applications: AC

Publications for DGK-delta Protein (NBP2-13917PEP) (0)

There are no publications for DGK-delta Protein (NBP2-13917PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DGK-delta Protein (NBP2-13917PEP) (0)

There are no reviews for DGK-delta Protein (NBP2-13917PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for DGK-delta Protein (NBP2-13917PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DGK-delta Products

Bioinformatics Tool for DGK-delta Protein (NBP2-13917PEP)

Discover related pathways, diseases and genes to DGK-delta Protein (NBP2-13917PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DGK-delta Protein (NBP2-13917PEP)

Discover more about diseases related to DGK-delta Protein (NBP2-13917PEP).
 

Pathways for DGK-delta Protein (NBP2-13917PEP)

View related products by pathway.

PTMs for DGK-delta Protein (NBP2-13917PEP)

Learn more about PTMs related to DGK-delta Protein (NBP2-13917PEP).
 

Research Areas for DGK-delta Protein (NBP2-13917PEP)

Find related products by research area.

Blogs on DGK-delta

There are no specific blogs for DGK-delta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DGK-delta Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DGKD
Entrez