Recombinant Human DGK-alpha Protein

Images

 
SDS-Page: Recombinant Human DGK-alpha Protein [H00001606-P02] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human DGK-alpha Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-735 of Human DGKA full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRLFKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLEMSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIMREKYPEKFNSRMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLNIPSMHGGSNLWGDTRRPHGDIYGINQALGATAKVITDPDILKTCVPDLSDKRLEVVGLEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGEPWMQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLS

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
DGKA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
109 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DGK-alpha Protein

  • DAG kinase alpha
  • DAGK
  • DAGK1
  • DAGK1diacylglycerol kinase, alpha (80kD)
  • DGKA
  • DGKalpha
  • DGK-alpha
  • DGK-alphaEC 2.7.1.107
  • diacylglycerol kinase alpha
  • diacylglycerol kinase, alpha 80kDa
  • Diglyceride kinase alpha
  • MGC12821,80 kDa diacylglycerol kinase
  • MGC42356

Background

The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It acts as a modulator that competes with protein kinase C for the second messenger diacylglycerol in intracellular signaling pathways. It also plays an important role in the resynthesis of phosphatidylinositols and phosphorylating diacylglycerol to phosphatidic acid. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6727
Species: Hu
Applications: WB
MAB5125
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-14868
Species: Hu, Mu, Eq
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
H00005555-P01
Species: Hu
NBP2-23368
Species: Hu
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-98413
Species: Hu
Applications: WB
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P

Publications for DGK-alpha Recombinant Protein (H00001606-P02) (0)

There are no publications for DGK-alpha Recombinant Protein (H00001606-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DGK-alpha Recombinant Protein (H00001606-P02) (0)

There are no reviews for DGK-alpha Recombinant Protein (H00001606-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DGK-alpha Recombinant Protein (H00001606-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DGK-alpha Products

Bioinformatics Tool for DGK-alpha Recombinant Protein (H00001606-P02)

Discover related pathways, diseases and genes to DGK-alpha Recombinant Protein (H00001606-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DGK-alpha Recombinant Protein (H00001606-P02)

Discover more about diseases related to DGK-alpha Recombinant Protein (H00001606-P02).
 

Pathways for DGK-alpha Recombinant Protein (H00001606-P02)

View related products by pathway.

PTMs for DGK-alpha Recombinant Protein (H00001606-P02)

Learn more about PTMs related to DGK-alpha Recombinant Protein (H00001606-P02).
 

Research Areas for DGK-alpha Recombinant Protein (H00001606-P02)

Find related products by research area.

Blogs on DGK-alpha

There are no specific blogs for DGK-alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DGK-alpha Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DGKA